ELF( 44 (p(M(MPPPPPTH8 PPP4QtdGNU@-  --- 0k000 R/ 0 R  / @-0S0S3/Pp@-@0SpPP! (EP Q 㙼2p@ * X' ( z tQT@-<@P Pذ$0   PQ@-o@]@- @Xr0 0Q@@-0S3 -R rRMp3@-3d@0-QS rR 88P,ne(le$je he4$@-d2@-@P`80S `EԼ@V0S #G-`Q@D 8R8r 00i n R $i R vnq on 0SA   0 S sQePt\0S. I 0 SX [;oPpp-Q ]2o P00- hZV ! h  ht GhX P:@0 hlHĥbЧ  d0p@-0AM0S0 p QP/ PU#PQ10Q ^ h(z6 xP0S^:܍p\gh Z`Z 5? `P l ᨮ  Ж̖ب0P@-0S㢤@PQ@!@- M- P 0BSt0o R PPHo8 MP(1@T> ^0Q P 0( S @@~ Ѝ P |PP@P`p p`VP Lg0lo@Teo0 @-M,@P 0DSXhLL d0o彮@ O!Ѝ0 $0 E-M`ᡮݭPJ:@P\s ᓮϭ8ZPm 0pi ZPc `_ ZP    X @#Y` ڥ "<`P= 0D 0QP ppP a:Pp .PK 0D 2 `v`3@:!0S`V#    $ `p 1la @:\1P  ;@9@xЍ@pT &pT~/ 3o~/<1@P@P V9@PPC@P @e `@ 9Pz W @o 4o$(4BQܯT@QG-@PRq|64U `Z r6}4U`i6t4`b6m4Up`0P@V@& Q $`Y!Pw 岬0 S ߤh 0壬Z>yZ>$O-4M0  +P_e1(0S @(P6> PP P P NP ~````NP$R   X ?WP @,<*P 0n00@ 0@ 00P(P(pPQ} (m,PĽ儮ԝ,0@R04@PP8@P&P0AZ ysR(AHP\!PP0S^d\[坧Pp pV Sp "jK尡Q` H[@0SXX R,  1kVP \;@0SJ B, 0S$\Z @[RH2XX pY0@T0I^@2 ``RTB@0S QH DpWHP 2XZH[$:Y0pW0L^8C, R0HDpWH 0T p/ e^ PPX R$  , 0 ϨPPPS D^40XQ <PXP , 0k|PPP,  Jis-S A (P U(@(@5pW$e+cgr@DjL@-$ !`08ev,̖@-@M0S R r]P e |0^ p! R > ЍD\] P 84`, 8XhЖl$E-A0PPP#Pp0 R`Q \ X` W 㳼4μhSP PPp  )pP0㚼P80t0@-0M20 S ;%@6xQTT \"D^H$h$$@@"@T@@@Tv 2 "P*Ÿ0S, Q 8 10S1!000S 1 BЍ0!P T1P MP0S  D0g818!P e=P@T!\)0 R   0 0JC^d  Pvr \ 58 @PP @.8@ꠙD0 į|hȯ0Q8ܞ/0P/ 0 R/Q B /ᨙ( 0S/P00/ 0CC/400S0S  R//ᨙP/0   /ᨙ0P0CP!/FP PPI@@P0 F\/Q/EP|0PCPBP)P;P {@P(P P &P P P81 R0/$ )Q1 FQ  P3 Q' 0Q#  0R/0P/ P P,( 0 S S0 S S iS x/t/(P \@ /FQ </0nSꨙTc ,$00S  S// 0P 0 00/p@-L`4@T 0PS  Q   @U4p訙8@-h@04 $0R080 ,@PP ݜ<,(@P ՜ D@ 8訙@-,@00P Ɯ @-@P0P S$   00宜p` 0p``H L0XQ`P  P O 00@$(440 ,0P0 訙U  Я@- &   訙p@-@P0 P`$ 0L 0H``  0QP 0 0p pp0P $(, 0pP { 4@P ꨙ U Я@-P`P0S p@0S`P @1S@Qp@-P,垤,ڣ@ᘤP 0 S R @  S C P0C TL ep@S0C QS C \@0CP Cꨙ@-H@P P`p ۛW c៣0i- M0 Ѝ,- M0 ЍxDd-0 MS P0S0S  R Ѝ 0,@- @-P 'P F?ASDD00St@ud00S@uuH@N4@0S@*Q|R<O-0rM,Ph ޣXP M`[``XZ@ 8P 0,c!pP00`0 p] PC`XP0E, f 0F8!pP00`0 p P%`X0H,0P f0) pP00`0 p P `X [0NЍX0 [ R 0[0 [X0P0EꨙA-`Pppd@UH0<( 4,0p 4 P000,`:0H0(0<ANꨙ@-0@\a@`ꨙЖO-BM,M0PP@@밺尚z0*0P0`V !V^P@; `!V M`BB]$0 zt:` ``PVʟ:@B} p^`)P i O StP 94Ѝڍ\V  0 R`0j000Rʍ0*P!0HVSh <<<<<<<<`4dDDD`D 4dv @`J}`ᾙPr0{S' d\ ` Z@5YvX`\ $$7 0>[WP q ' WX0 0솟L % [ 'P^ fZ`f0S@0'[X0  `0   aX0`0 eX00 rX 00:lL`%Q  0`S 000ş %`ɡ`|5d-/P $`ạB ᗢ*㟀 RR00`v p\  0 0 00BS00LQ0S@چB `nedX0 tX TX @X jAX ` ^ :00 0dl娠hX`'.֟P00@@X#L`vQ`\l#0Q#$  0K`P ;Zw`#P0# \r  #B _`B @1 0}RR`   }RRʍ^% 3 eQ*0  !0R`Vc 8Y`ʍ `!_@|V0PB-( ` B͍(` V`, /V9 / <P  hacP: Ⱡ `8!/* `!' `! JPs }|0R  0Sj /S`Ve ~ẟ`:DB(. JQQHܫ fxhd< Ȗ(Qd@LXpp@-0Sp@40S QpU`PU0\ 0`P `P 0x0Q0PL0`P ``p\P \`pB ` 848<O-hfM0SbTvP\H6 RQT4@`p[ f?0@``!p T%1P @0S/ P p@ P] L. 1p3&% (( RX^\ [ f?0@``p 0 S  Q Q, ^   x X4 \c a 0 S <-(0SX \^J [ f?@``p 00\%4\P   0 ^  R (0S \y h̟P \,APz(x8 ! $( RX0SQ J cR eR P@PP$ Q<T'˟(0SX0^S  V f?@@ `Sp 5p@< <P & P T^  [K#P#T Z @0T S ʟ!  (0SX 0SQ P #@TT*(0S~X \Py)T %3#(TP V f?@``p0S  \T  h )(0SX 0\S_  0[*ɟ'T Z (0SX 0S^0 <0\$@ $H)0LQ0E Z_ 0 ^X ( RXQ\R < J80$U$0[ 8 $< I<0m #@P0Vf?@``p0 @o (T00{T $((QX R^$T P W\ ' P  (0SX 0PS 0S f?@` ` 0R 0p  02 0TM Tj ;T&Tg |Te ,7, R (0S ǟ0C(0g0S f?@``,pTT (0SXQ\ 0 0 @ D( 嘙P ]}Q x \A) Dv4Y &DЍ&(0SX ZY [Ti $Trş(0SXP\i P ş, R ([K( ldP0' <0W$@%!#SP.[T6 $P: <0S 0Vf?0@`p $ߗ< $ R&  #@T0f?@``p< qpy -P @,0S ( R$d\_@dğ(0SX ZY[ Aa(0SX \Rj Ph00S "T [& 3P0\h(0SX ^Q <40 @8$I$) 8 Q$ ᥏8 0<0<0S 0ST $d<$P  I $z$减0S5 \2 ^(. 0S ( ( ($0pW=2P&T|T ;T[  f?@` 0 0p0P0 P0 ( TP\f?0@``p0C< w$ B( A@pW0P2P~  0 [ f?@ `p-00\ d P@PP) uQ$ $剗<0 {} <0$0] <0$$pxꨙX8\HQ$TTO-DMh@`P (0 "Z'ZP"Z$@$r넚p$⤰@ T 0@p,@ 0 0'Z 'p@ P\  `Vg?@p0 TP @#T\[ 00S S )  (0SڔX \^ T00'Z0SP] [`K `P$'P00.)/ TT!( RX R\ `V0g?@pp @ȟ^  0BSxTC Q {Q\ {T T  R ( R ȟX`^V{`V g? @pp 0 0 Q S!\T1 Qe ǟ1 (QڄǟX0P^  0[X 'T [4 (0SX 0 SR$ <06 NP  [ ƟQ ( RڜX0SP < K80{R9$\z 8 < `F<0,(Q0ƟX` VRs `T"^(0S3şX0QS-`\C A (T{T  0[T7(QڌşX00^S. T00C0PHRL[T$] <085P4 <0S 0Wg?@pp%< `Q R$T PP( 0R0`DЍ(0StXP\ PTTHğ( RX`^V 0Sg? @p`0 0@`c0Sg?@`pTT (0SژcX Q\ 0 0` @E(QXcX \^ A,\T [M (0S X 0\SD P&(QX 0SP PP $' <0Ì  0HV뜀do$ R 4"TP& <1S (0S X P\ <00 A8`F8 N ᎌ800<0$Q <0S 0W0J< `P& x$L 0 0 0! r` $<0!P* <0S 0W#<`P Qg?@p pg?0@pp N 9Ô<~3< n$ {<0} HꨙX8HQ$A-@M 0`() @5P0PpP )P (0SX QP @P  B@f 0CW@ Ѝ (0@0  LP )  P 0 PꨙO-NDMDPU FEP@ 0@D0DЍ$0, R" `/pP 0 #PL Pl $ 1 (0SnX\Qi-U 0S0pE Wu p  R00.0S   R \U   ( RX R\$  |U|U(U( RX \R Q UU0  p000E $U \ Rp  ctpp UD̟PU0.<U>U  y$p,|U &P00  ( RX\^~  ( RwX PRr>X    (QhXQ\c|X [ (QYX\^T&U  R ( RX ^R|UP ( R=X\Q8;U00S (0SX 0PS,0S (P@( )U (U P*Q<U>U/ (0SX P^-U 0SIS (0SX ^R0S ᴰ(\ @U*U +U?U !U $U00$U<U >U [U  W=UX7 (P I?@C\$0 , =0 $Ơ 0D    P (0SX ^X (P. ,0S ( R B(  1 (0SX XR , Rf Sd C(0[ <U>U 0'S IS (0SX PY P帐FUP 0اS  C eQ  $ 7 P$PP{U  7GZZ 8[cWZn $  ]R0]SPU\W%(0SX 0PSV U(P ,0S ( R B( I$U00$U<UdH0@0(P {P[P S 'X'X"X% $X(0SX ^Q [$00 P[ b*bpP㒉P0 R P\'UpPQP $0 d4W P I@A^*P' $  $0 0"P (0SX Q^ P[] 80PqP|U 8  R<aĠR Q <R;R0p80Up #, R (0S0C(0dS ( RX^PI {Xc (X [] 80&P#[ 80 R<aRQ <R;R0u0 p ᧐8 [p   ӈ( RX RQJ ; P ,0S ( R B(  Q`Q \ SdQ`Q P"Q \ N@\ \ D0AS 0"(0SX  ^R  0ZT0P 80 ,0B0PP X84 0 Aie 4hJP^44 P4< aSQ <S;S0U40p  P3 PX"TH H8% \ 2!.dQ(0SX \Q*  0X   (80) 0A0Xn 80  R<aRQ <R;R0ap(0 6 [`U 80 B[1 80 R<aRQ <R;R0$p Y8 "Up 0[  D ~ >P6$ 3 (0SX PUP5 (P2S^ H R ( RX^\ p P,0D#S (PUPE(P  R$ P$rГZ (0SzX\Pu PP0.U00SeZ (0SXPUP 0Pv P ׎0 pS000W000P X)\Ɍ$tP `  `5Vt IF @Rl$0 p4 Vs IFNQm% PPA?NPhUCPF_\ $T$h%TP1  P P 5Q| ppPQ; \0؍0P$p P U BU 0&U$ @U  H&U {U }U cu P $0 ` V6PP  M $ $ X() 80q 7BP 80  R<aRQ <R;R00pX8 p ( RX0\S $Z$P帰PḀ崀T F$ 0)P P' F@^PXeP#)PP $帰:Uᴰ$0yؘI `Z `4)XH0S T  BQdP 0 0U00P)SS SWiQ BC0@SPdUo\^ $㤌PPdUt {U\88 P P}U R@:K8-Pp\^Z"SRZ  0P :PN S BC0@SF 0\(8 0A0C;UU$ 0$0&P ,0+S (Q A([k 0d0dg0oS)P&\^ nRh ReP$0 0  $0E_O0eSp lS20eS/tQ,^)$)$ % =P$B_0$02\8 T8)>U^$&U\ |U\(U =P P <PtP , @R (0S C($T](0S$X P0US SRdSO R#S s`P"  @ PL8P~< -$ $.St @` PuL"@ 8\ $PPb 0 $ P]{\_ &\\ \Y \W (PS ;PQ \L 3 L@^F$P帠g Pc I/@B\\ $ 8 8P+ 0,$ P&8R4RK_(RI_RPBUg0$PGNA\c8 R  B8 P88P\0$PP $P {R &R R R 8(\ ;\ 2 !\ *LN\)P  P"  ϊP  0Q S 00PZ   dqGL NR$Pt.$d%'!&)*d̿ #-+"O-M MgNpp0P8@`o,0P0 Ȁ0Pp( (尠 U$05):ϟ X/刀X!09P @g@ P$P0$!P сH@DPpU(*$ pAఖ I8s qt Q ڀ.Q"ѕ 0S0AP xZ  @Q0i 0JS񟗲--.-,,,,000|080///H/$//...p.L.'T'0''&&&&`&<&&%%%%%%l%X%H%<%$$$p1d1P1<101$11 1\;P;D;:|::9D9988\8,877476l655L5 54/l/,t,4,,+++**x*`*H*8*(***))L ))))l)`)H),))((((`(L T(L 0(L ((''44L L 4444L L @4 2|1;;;h;;;224333$33 33(@0Q R 0+0x|˟!10 1S0C°1 AD\剠;0A0 BjL  @Rk J LP$0' ⰠZ, Ro ,\a  g0* Iy YA R s@DPఖP IyW4 s@DP&rP  R A΂P Ps@A⅐IyP YAΉQ'ⰠZ fZ `)@0,0' ⰠZ @P lЍۍ A Z'= Ⱐ0Soڼ g000 g0ȟ ȟR( R R(0Qi XQf DQP^ XNQ 0[0   0H $000 0 PQ 0 $CfZB ,0P@,S4ǟ00@ǟ@"'ⰠZ: j)@K8D( 0Q, Ph0`44$40 a 0| 0P n0  D 0S0 0  0S08  # 0D 0S08ȍ (08 ȍ(  0t  2P5 ƒz,  vq5 mh  Žd_ " \W0  2SN " KF`4  ƒB=8 8$000t, Ž'#000t; 30& S  * <#$& ^ ȍ (Q E": 0  08   ( 0  08   (00= 8 3 .   08 _   Y  S  k   B z( < t 6 n *c D 0S0 0 0S0  L 0ʃB''\80.QTD 0S0 0  0Sp  : *00  D 0S0 0  0S00 ( 0  Ž 08 2 + & 0@T0 AP0^ L 1RG0a@ WPLPgPPP#,$0 @@  9㉐$0@0i<"`$0@@L I㉐$@0i@|@"TL 2@Tt 0b@ { v0 2r m  i d0, 2` [P €W R0t 2N I E @3 ƒ< 7 0 / 0  '  # D4 ƒ h  $000t Ž $000t   Ž 85  \   (08~ } ȍ (&QD&$@ 0600Q@FT6L(0\h Pc a0i@ D0 ^&  6\&$@} 6Pw0 7剐L(0@Ph Tc@l@0i@P000ZQ000R OL (I F 0D R  0 R| P 2| J , ( (  00 R@8D  R 00 ( R 00 (;(0S($@ 0\z ȍ;  (D@! 1  QA°9!(  1S0C°1!   0QA°(@0Q P 0040!10  QA°(@0Q \ 00!:0  0!R B°!w(   0!10 i !R B°!^H(L   0d!10 P !R B°!E    0!10 7 !R B°!,  o z 0,!10  !R B°!l m 1S0C°1 a !R B°!( U ,1S0C°1( I QA°40=!80  1S0C°1xt!810  QA°(@0Q P 00!=0  0QA°,(0  H>! 0   1S0C°1(  >! 0   1S0C°1s   ?! 0 q  1S0C°1ZX \  t?! 0 X  QA°A>08;ȍ8; P 2& ^1 G )P!A # ( ȍ$!5 Q@0] p0@Y0aV00cP+ ( {# t  ` \| C;L`l 0 `L0 0`@0d@# '0@dЖ,\,LO-,,r,B,M Rb TH 0$P 0=0 F00P0 $0 娑娡娱  B:$0 P P, F?@S. P\ $RP$B 0 $ Q0H & Q 0S ,ЍO \T$ ᴠ @TQ |',Ѝd`d@PUPpWO(00UЯ.d Hp@-H@HPH`= P 0S AP81 P p訙8E-l4lDT`P0P0` (PJ HP FP PO0  oB` Rw`P s0!S -S 0?`FPPg <U>U0 lß UU tsU)Upp`  0%P`0)S ,0``P  TP^ Bx $0嘢$FPW 0 0`^P M0PP T 4 Aaxb``~  'A聟-P0 =R~Q0S$ $PUv\Pr `eFPD 00 `IPP$ D Tp AxT`*xPP  Tp Ax TPA TPATPPT`h}d TPmA|xLX@-, ,0Q@ 0@8ꨙ@-, ,0Q@ 0@'ꨙP D 00<<< 00/( 0/TbbP-R 0S S SM0S S SEB 0S S S=0SpP? \< 0L0 S8 0 !@ ?T 0D@ TW r0/0L\ Z` ?0FV@ TAS% ?A`S%0-S+S-Spp 00S 00C S RQ0 A//0S dd  R >S /S 08 S  R$S<S//XQ0 S S   0Q 0 S S 0 S S/ 0 S/P 0S /S .S /0/SS .S/PP//A-BPy  H00׳1P^aPPU00S RX0@@@R;P !0R !R 0S5S>CpP! P pW PpWE @PP 0R0p@R 0R0 PT`PŢ PRXN)P PR|Qp@-@P MP U00Ѝp0S% S(`V ڔF Q 0  R  Q 0 @@Q000U`=0U00|0@- MR$ 0S! @\" \ L0 S 0 SR 0S 0 S !R SA T0ЍQ|@-@ P0U04`p `Pp 4d```Pw4D0D`Pn4P `|PP0,lA-`p$PU P00P PQ40SP$`@$P (0@S,$PW0W00|A-@P0Qp`00 Q   ~Q ሸp`p ~Q 0S/S :S 'S \S "S}|p`輲|A-0@/SSPp \S'S "Sp\S'S "S Q :S 0/SSpd `j~U00p}}|U0`0@-0+S -S 0C \+S-S 00B S @T ]}|@|Q$2@ R 2@4hp@-@PPp?}0P@S R:R   :QQ p@W :R0 0 R00:0@0@-@x2`P }PP  }`P0S/S (p( )} (@~(`耾|'Q@-@ 0/S  @,|@|8@-0@~S ||@/P  +P;t@8@@-0@/S /4~P@P@-/;P-lM P  PlЍ@-@P{)p3-lM p3lЍ@-@RMP S `WV Ѝ&QPp@ 00P ` P0@-@PIPE000@-  @- @ P +@R@-0 M`p@B(W  R P@DT00S0  p0V00S@ Ѝ p@ W P P0@@@T00>P Ж@-@0P @ @ 0@-88P@$0>? P}<Ȗ8@-PP @T   5_T@@ 0S 0PS  _S888@-@P0 !%_S PuP3[SPU&S$ =S" [S! !_S00 0S =S8[S +S =^8@=\ 8᫠0]S0+S =S88@-0@0S 00C S0 \  0R0BP  =8Q8oPP u<8Hp@-`QM@ 0 0 0P0S0S00 R R T \ RVЍpA-@PM {PPЍ00P 0S P `V0~SC S /S0S ?V P/REP;*/^ 0E `0 AP-*\ /X> `% AP:!` A/^ ` HP*/\`p` 0S /S0`p`Q 0`S.  Pa`   (`p``p`hE-M0p`0 000 h@P0`pZ  O3ЍTcx p@-R@PP 0S ` 0S R 0 0p`0:p@-P@M00  0000 0@-@:0T 0@@ 0@@-@Pp`)0p0r8@-P@ ,0 00P08p@-@`TP 0S @ Qp8@-@P P @ 8@-@0 @p@-@ P`0hp@  p@-@P`0xp@A-@Pp0U`@ P 7P PA@-@@ @A-@Pp`00P `pA- M0 0 Ѝ- M0 0 Ѝp@-@P`spp@tp@-0@P  0;S p@P^ 0;S PU ;^0 PpPD0@- MR@ B Ѝ.꤬p@-M 0@R`P V PЍpU   0S  P@@-@0 R  B 000000褬p@- @ w@ T`Y  0 `U`P@  a9\00>  Ѝ1d6[@T P \ TP@ T  xP0 S xP0 S\  ЍO@9 Я,ЖG-@MpP@ @]w `V0$S "S P  d0 \P@@VЍ'S `S 00@@-@v@0P@-0S 72@0O-0P M`p Q Q% ;QQ @;QQS:0PU9 U/ U00Q 0Xn0@T 0 c U$XP? W8 V p1 `* ЍO00`00pU ӄՄ  7l   7L Ѝ8q`(mpil T' qa R  (@T 0X P 'P )0S00 (.g@T G2) TP0S00(  )\.Ж,xp@-0P@P.0 v( p@Ж0p@-0P@?.0 e( p@Ж@SA-p@`P)`V`P00S V 0 I(A,D('`Px)P` \05(T V fO.()` s)`Ж-, - M0 0^ ЍЍ/̖p@-@PPp(` R  @Tpx0 @- @(꼬hp0p- \ `P@!p/p갬p@-@P Yfh 0Q 00`P0000000App@갬p@-@Pp` H0RP0S +f'fU@p/|@-@PP P P @fA-@P PpP PPPPPPP0VA@ ` 0QhV@褬A-@P P RH긍܌\܌P܌8,0eAePeP ePeIP eP Xe0.P* wep PU j`veVPqe mehe@-@ yP@[e@-@@Ue0S x0 RlQ 0S R R R 8/0 P /0/hPO-`RM  @P@p & 4rÏ,h p p /Ab! @0 Q GRp p  Rp!mh`1C #/Ab! C00 0Q @R 0  pRUD 0.0p> E[0 0 U,[ J00 U ;0  .0 0 UpVs00pЍ艈gfff0 R/S0  0 000 /0  0/0 0/0 P    /S@-@ PP0 0@-@PP00@-@P00 P SP@-@T@p@-PPp Rp@`@R 0S ` @Rpp@- P@ p@/.,@-@P d@dG-PMpP4 R`@-T/ P p D.T~PЍἽP T T P P ~ pVZ0#S @.嶁TP P e `@ =T P  l}.~TC1v5/<3< 84c  }ß@P@@@@Lv!`#V@ 0Fa!0C @`A0CpSp0! 1pb P-RUTRTbP pW pVcp\Pcg  @!Po 0 S S  $0 S S 0 S SZ pk@@ \5 X W*  4-c~&Z2 S0  0 0 Q Q0Z Q Q Q 0 Q Q Q -~w^ 0pM  +r5t갲@TP  $0L@-㌀u㇀@up@-H@0 P0 000 `8kWtj!pSp@-@Pp*kI$ P3$;9p@bd@-@PP b00  0 000  0/SS@-@ MP7 jP#P1 0* ` 0pp`הUb 0 pp`˔Ib T# @s;b Ѝ@7bV Ѝdp@-@Pp@0SS   0SQ0 0 R/S P@->00g@-4@P 0R7iPS@-@:@@-@ P0 0Ppp@-P@ ePUStpt XP0t03T0Spp@AJPpp@@-T@P @ r@i@+'@lxO-B`SPp1䑟 U: !U7 Б U4 `v`3㼑P00S UB pp5/0S``Vp dU< [-X 0L t{ 1P5 ,U2  U/ UV{Q- +'V r{v3`Z{ R k{_{x R t:{8L]{${`v`3`꼯8,lH`Wg5`Pw A9 r TЍ<"2Uo `,P R2'u x0 S\0SW P0 3d, 0㟽P4Pk '0P00 kP  & P  $[ H _y1Q0S RD|TtL|x 0P 0BqP 0#@ ⣡2T` 䪟 p3U P^>`& TPQ^\0xZ    `P [ $^X `v`3 BQo`st006\0dy `  `0PyP)S0H0 4ɟP 0`0 PPAqP P ^Xg6Sf(_sȟ0PSl Y`H\0xh |  pdh0Ptȟ^P0 H(P 0`048PP}AUqP P S^Xff%sP\9 X`lU0\ Q   x 05W`V\0W   o`LD0j'W`E\0 dW  E`:fP p7PiQ &`V `W' 10|R(0x &R~ ;RE 08'|\0V   ` H`0BH0L`pP.(\  R ` 0x 0;0 0```  H`#%5 pR \ h%L\%^  I0U w PU}(P P(q   V00 SF$U \ $PQ 0^0|0S V Z `#s{\0T   `\0 pT  `}\0LT   `sB0pPP  A ?T` rx 0 mwP ^ws{# {L3wU'+hß\PS`Y3 RPU Zp 7pD})`W \DPU R``GoBF^U`00Q   \`8ŸPU0 VR VRP (^ 0S   ` QB vq BoP,( `P\  @ 0SW  , Y&`4Qx`PP 0`Q`BZoPE0a,!0^40,0S 0|S(`rԵصȯP8Ԭ ̬DHT(@,u GT x<@T'@x î <0devxYvVv RPv@Mv,0Q ^   @0 @\ <0@0}v `V 0S0S 0|S<~P` XQ@ (% `)z`,P0000xP P^`G\!^Q,00, 4.VQ,4 0VS ?y(^  \000R0000P0 b}y"^ y0\ oybP yx00 0S L `pW`8S (x^0  d3 P  0` R`i\c0 P (` V0000xPPES`f`T``D`(T\BnP000 `` 09t0P .`-}p7y 0x@@p ؄*y@ (#@ ($Fy.%x&`o<,x'9yD%xp@-PM$P` @uu 0@PXtX0S L0 R@\ yЍpx=4PTO-TM P P 00S $\  Ѝß0   9Wtt00   P d br尲尢専@-Q300\^AhmPh"P\P bZLb 82&b(Ÿ2o RP00 @T/ P !2xQ x 0q Q6Mh1 P+ ^"\t0S=h0S C^  0N0 *t q Yx  w G1 0  Ql^ `tT P 0L0H0C0h`ppxTP@@xHеԬ ̬@Եص O-`Q`` M    @1`!P ` 1^  b PO tqhp `0 S & ^- 0# P5\00S' R" 0S. 0S CP`iQ 0N 0Ѝ0wAwwD;w  CеPԵصO-TM8fP@TЍ8p9pɟl)@@<XP 0SAlP4)P (IP YYa`m@PT@X80 DU$:$ZP Z x<@(s|$s8`pxPP`h   8 H@ PQPcR0,0@TP,P Z,xQZPP,PeuLtE`uttP.Vu8Bؠ$N<qP #@}Dy ^0P $\Xp 0@<B@ptԬ ̬еPЖdhlt'X|@Եص̖H d#0O-X0P#M@80SAiPßP sk 3PQ " ЍRP Vb _,I^Vk2PQmTPP u0[dp ppXp pW pN @@@@@ @Qm^p@T< pp0S1@T2 NT`P 0S P PU0 P 40Q S0 Ꮴ'VPP <t0S ft@TppWV%p |nqPp@^@\  R     0 pW 0  pWd0s^ 0t t:ㇾPhԬ ̬TPO-@Q`p`p0刱0 M``` q 3 XaQPqP' P \)PZ& P/ R20S3Q5 0S0S CPQ,P \ 0S C B ЍPXs R s0S LsQ sеصԵ0p@-P `@ e0` PRPP 0000p@PR| ^ Pzs Ps@P osPs ^ E-@$MPp0 P 0`  P   l P P  000DpW#o5 DDoUoRobOo oIoFo嬄  @ AgPBgPCgPpZ d$QDP AhX <4\D^ BhW AgP D\ Chß8 08 0 P@CG} C}$c@ :}pT@T< 0,ßHS`@$`@ `(C`P3 (#`Pi#`Q;DP< 80 C8&~~ !~}|0P   R PK h2\G $Ѝ`$ppphDŸPPU< $2 "Q DP7n D>o RkeCfPA1 q?BfP53AfP)h' u P0p P``Ph1` Y\x [m mK\j[@mm =\\y[tmtm }^}i(4tTеPzzz@-` M pwTP@mDm 0_`^m ЍE-M@@`Tx1 8<  zxT1T PQ Dp PMYfW  e㐱P R) 0S `V+ X P @ QqH 0 |PpUH 0@< @,p8\0IPY0,kP\ n(PU@ sNYmX  'P v:*W P|S KPk h 0( ]Z  R R %^0(0( \PPm 0X3P0,g;($)4)b@EPdb 宮PR쒟t Up nW jj0U0l $堢.}PMUM W `pPjP B  U1 $ \ M{p АPpZ e?@Pỵp$(0, 0Z040 ,` MFtЖQ//// "!/0P/ 00 S /0\//  (0 S/0 P/ 0P/ 00/ᠭ8@-,0@PP LP8萭o 00RS/0 00RS/Q@-@M 0S ( Ѝ P  Q@-@M 0S ( Ѝ P  ꐭ 0S/h@-0CS \@^@ _Z@-`@0PS 0Sp`S`Ȇ1S 0RS0PQ1/(0  W0S蠭S$@-0@0S R0 蠭@-P@ R 0SC Z 0 @i꠭@-T@ `0PUp 00却 `Pp!% P!蠭Z@-@P KP Z@K8@-8P0P @@0S008蠭t @-@ 0S P 0 <Z@, ヿ@  }@꠭<p0@-@T0  R @TP 00Z00蠭@- $[P0Q /ᠭ0 ꠭0$꠭8@-@QP8P8@T8Q8@-@ lPQ P 0S83/8<0S (PP8 Q꠭4 0S$0\ Ql`@-0@P0S C@Htp@-PPd0P    @T P 4p@P  %txS@- 0P@-P 0 @載ꤴ@-P@脌@-@3+L@-0 @ @꠭L0p@-@P  R P JP U88YYJ$p@ ~p@꠭<LP@-0@YY0 !@꠭SL0S/꠭C- MHP7 0@3 @P"   ZtPP  P X`p Gt$t  0X  :tPP 0 t Ѝ@G-@P( 0P$ P  T`p  r@` pTk@ rG!JP@-@,P 0ST8@-P 㴲@ᰲ0P0088@-P㥲@R⠲Q0000 0008p@-P`ᏲU@ iR∲Q0 E00 0p蠭p@-H@P`P 40P IMRlQpxp@-X`@PU PZPWP9<(Q-PIP+(蠭 A-P }p0S  R00W0PP`AT PP ]}@T0`^P舴@-@A-P q}p0S  R00[W0PP`AT PİO $}@T0`^P@-@@0@- ZW@PP GG蠭0@P/G}r@-@P0 P GG !@GS@-@QPZ@TW  W`P pW 0H!  4\ 0POlO@GG5G00*@*P G PZ 0PP0P wGPPG蠭VSA-@POܯN0@=S`G 4rQz PP{ P GVz  0P0 ` pGpOP౯pN=00PK !pI^2 h!^%F^  R mO E +Q P!  \  cF 0F0FSSQ\ '`D` vNU!PJ`~꠭S@A-P`@P 'At p @ p@O-JN0 _V@蠭@-@P`P! P mFP T@ p0 ^ X !P¤NN,0 $*VpE`SV@-(@ @7o00蠭O-`,MtP 0? @T !;X7 0<P 0pHp?pX'W   0+P 00pXp  0@ ?P!p  0 ?pX,ЍSRPPXPPUPpfRp pEP !ʿZX  0  ? ` pPaoX R   0! ` pPaoXС` p @  0   0 PPo  0!po Yʈ0op p 0 ?Popt(. @PEh  0 S@-@P`pPV0 @`P`G-PPq 0q  Q:0 @T p1  \ @TH ۸bP^@ U3 0 5 Q2 wZ` PPP 0IS P FR0SSP,%P `M LK`P 4PS꠭8@-@P 0@PS @88@-w@P 0mPP8P/0@/ 0(myd^0E- M@P ' R) Z @ Ѝ ) 4X`0      @[D0S`pbxbLL`Q@ <`Vf@`뜡PX` P`U P \ ^ Lɬ `KKQ` L`ᶬ `KgȀP`V@ 0S@`  R@` }L`@0S 0S0 0S0 nL0@KKabLK@YE-` MP(p  D @30P001&@P 0S$ P C`0 0 0 P 0$ 0S:0p@-`@qPP  p PPP00PR uU000p  U000p@- M@  0= Ѝ0@-M@P 0 Y ,c 0P  ZЍ0ltp@-\PM0@S` P Ѝp 0:h꠭p@-`\:M@0`( 00 0\80T@[stxr PP,@-0S Q@f<8@-@}PP @P008@-M M_@ @$}0 4 $Ѝ蠭SE-}P@0S 8T 8@l@l1hhph` 4b!0`>#(\1S1蠭SA8@-@8 040PP @P8蠭0@-Q p@hp@-@PpQ l0PU PLp@@4p@R@P  Hh8@-PP8@T8( @ T8H0@-S@0 @L @ @m$ @ @m\h@-@PP0  P@-M} 0 !@4 P000$00Ѝ`8@-4@P,@P 0  PU 0P6T Pʯ@P  0 ? :8 R T0P ᖯ ,40 ቯꀾh<=hS4\0@-@M0P 0SM0@ThQ0<@<000=TE T7cT(T 4?!dPc0@e_ 0@f 00 _0 00   0!Ѝ0/L1b@D0@0 @ 00 0 P0 <<d 10 <0 tQSgfff|@-@PQ8@-4@P@lP 0$}] 08蠭@-@s]L0H0$a`8PP >P  @-@f@p@- @0bM@@-lPMH@`T Ѝ > 0pSHH ?h @P꠭@-@ 0 ]p@-@"`AiPciPp8@-`P@0S P >"GA^F8P x$V8@-@yPP z>P88@-@PP m>P88@- @,P,0 (PR4 O{88SG-P0S @倐, (P`p01 `, \ 00CQ( 0 , (G,>꠭(p@-@P`Pp @8P0pO-`DMvPUl @0S =S=Sp `PU8j0 z(((j$ PU  !>   9 @T ɟQ   : Yp0@Ig x pX py0/S .S~ (PP Y@=B]0xA0S`19 Q  R B BPp@-LP`$0S@pP p@ $k@t9꠭@-@P O- M`4@TPp PX AAQ Z  AAP@TQ   Ѝ0,DX 0X AP  R Z Aġ@= P  0@ X A-a1SA(P =( R0 0 QR00$ LQR 0R0 0S(0&qR,P PP ^p8W iU 80Q !00. hpR0(dP0,<PP 6@8T A !S (@-0S @꠭@-@Y008@-P%@ P  P P 8p@-@ P` 0S3D R p @ @/|p@-@PpPPP@TUpp@]p@-@P P@TPP@ 0S p@Ip8@-P@ 0S  R  @⫠?8@-@㢠@A-@P2 㙠P` P  ^8EPFFE EEDtEFEEE4GGGv ` 0@`@`]@ R g @@@@C`@` @90`0[@`@`&@ Q y @@@ @T` pp`$[ 0p@ 0TW t` `@ p @` B?`rp؟`@ *`]@ß`! @`Q p巟@`?ⱟ> `>8@-P㣟 @ m 8P0 㮪|-p@-@MP P fp0S  `P嗪;눾4r8 `P㊪U  +ЖUQ40p@-P@ t0 p@|@-0S 0P QtpKP  P 0_P R,PDP ($-A-MP`lp40S8(!Q AP3  0P0,  0S)ЍA Ѝ/@ T{=P|p|@0pSp0  lPL@ TL 8 068Жp@-M@lTPx pЍp@vd0S@PL<0`P<08 㾩0 $@_ЍpЖ-0@- ML@P0 0@= A Ѝ0@Ѝ/Ж-0@-X@ M LP剩-0 0q C Ѝ0@Ѝ/Ж-@-8@M0 0\ .Ѝ@Ѝ/Ж-@-0@M0 0H 㟍Ж-@-P@Mm 6 $0SЍ@Ѝ/㇍Ж@-@ 0@@-@ &@ (0@-@  @TT@-@`d= @T8@-@  BR P0 Q .501\ '5 1#5 AR 58@-@@@-p P M0@ S S` P P  l˨Vd``  \ Q 0E8=$0=5D4G-4B1 SPP S=S`p%P l 㙨US=r<P`pP; 44P 4015=먡Sp<P`+Z8 /Z; !^Z`&p' |Z`p&Z`p %Z> Z2 Z6 h `XAWƠQW8 `p`-Z s4 <\*Z &&p``p`V p 0  0[`p h6p( XAQ`p 0  0G`p4 ) #h@-N @1,SH!,R O-PP R 0 R R0 R`p R R R R 0R R R R0S R 0S A  Rj1aS_(㖜no㠑夡p  1$ր  0 夁堁Z<y; 0 ᬁ `pP$P 3 P 3P 0@Q ء ᬁ$PnP !03h aT DP[{ ! Mm 00@-eM@b/G᷹P P d3| P _3hPQ P@P0PPeߍ0*b/\0@P0pGO-HMaV [  [ [}[!a!Ѝ[ [ [ [m`[ [ [ [d`V0[ Pa`ե0_[ 0 Q n? Ჰ᫡_Y pppu[W. 00P 2w;n┛:p qpQp `ᠡ᠑夑렱[ =[0ISn?[p堡夑a&㤡Q [ P0K Qp`=V00=[=V1P`1aQrp0#[@[_[ 0Q0A0`A0S`  S\ `p@SXAC\?$Y7  b0 S!  &&``p0S> #S _S    0C Q0 SD :[ 0S>R `p@SZ R  `p0nP`!QP!Q]Xd P    TğZ ]X 8T@T} 2P+P]X( bP ^Nn?ᠡ9ßP 1![Q >[: 1P`=0> >0e1P`4 `0S xSXSPB0P;_0]S p??0> _<[ 1P`<V \ 0=S 011P `P1 `aCP W0C0O>VQ 0=S 011P `P1 ` y_@Tc l1`&V&[1P` |V|[P1` *V*[P1 ` -[+[ V" S `G!K][P1 !R>1S ! C]R(^0CS, !x\'  !11S P Q Q Q Q _Qw-V``Pr-V``Pm` ٤1fH P P1 `\@(ԯTh\O-dR MA0DS+T2A`DV -T`pp ЍAP  㟤TnO``p R@0v(T0 pDWh {`pnT`41 b㤑嬁嬡崱0U0!BQR2 0nϠ1崱`ᬁCAQ1)S`p  Ff5RAଁ@P4 Ka0}P Y0hT0@-1!S ~S @V 0  0pO-Ha! R@P T0 0@P  0 ! R p ܣ p @,0 P  (!  @, P @ P   O-᠁*XPP/X@@%X,%X`p  U TX  0Ž;#  0ᴎ  v  A-d`pA-TPP+T@@0 QTU `Vp`p@-tp`@Q EP8 U60 `2 Q `P`ATfQT@ EP@6B PAQ`A-P`pA0D<T<TS>TAP00D``<T<TSpTP0``pTV0``pX V0``p@-lP`pA0DS T AWV0D``SpWV``pp@-8`1&S@P!&R@P pp@-8`1^S@P!^R@$P% pp@-8`1|S@P!|R@P p@-`qW@P ~ 0B0@@\_q lA-xA1S`pPX 0B0`p1 ``SpQ G?S@QU:U, 0"G0CP!:R  9Y(P   0 L'P , : 5,aP< 0R 0!R//<`0`  @       $ ( , 0 4 8 < /ḯTHHa 00 !4R0o;0 0/T<T8@-@P0⢖l0a ^  R0 0Qc0 0 0^0s  8(@8@-(1 @rRP\aR R AQT@8+Q P@P +Q-QPP-QnR@ HR-Q l\ RPpR rR-Q40S (内+Qb긯<$ 00-PU0P  0 P Q  <,R0/  P @P0 Q /0/ 0  / 0  / 0@-@T0P0 0 0P 0S  P 0 P 0S 0@/ // 0 Ж@-L0p @ RpT Ж\0@-p L@D0 \ 2fpT TЖ(@-[ 0Q@Ж8Tp00`Rc 8@-@PQ8JP8TD@-}JzJ@vJ@-rJoJ@kJ@-gJ0S@ܞ\p@-@P0`Vp0T  0! T  <^\Ӏ ET Pp  T T0 Q p 0@-dP M0S@  8gPP 2J Ѝ0@-J갲3A-`MV@x P  l Tg{ 8sPLU`~ S gT ^XXZ | fTTq Rf 0P ,L,Riڀ@Qr Rpp2UP U -6P LR1 x uPUX Ÿ^T0P  PE0SB P'  T PT PPIXՕ0 SE S 3 hPu u~ UЍ4jI0`y 1@0P ̠ ,R @DPx0PxvU,BPtT TTn 4/k@@eh `4} DD8qFIV ЖvTD \0@-0S S Q L 0@t0 R\ {I L I>P =\PD@@U,0  A0@(@^8  }(@-PP0|2Q, A0s@ 0 S@0S  P `v  P@0S  `0v \@ ` v `V@@aQdU R1\0L pr ` D  \ 0Q q  Q U @DT \ 0q Q U  q 0  Q U @DT \ 0@DTR U @DTgP 00 TE-R M`@V$0T  0 T. spdpPpWZ  pW R (sP pR sP P@-_|,PTp  R sd P1pETzZ p R rP !p R rPppu R rP pETT, ЍO8,p, ЍO/,ꜲO-@P$MP` pWQpp 0S ,,@$ЍkP p  pp FP`PDP0`-$ @W6   R xr0PpW%JS R hrP R ]rpGP8 R QrPpWZ'9``##p,Pp⍌  0 PP@;P#WĢ R )r0PpWHJS pWHJ R rpGP HR  rP P8P` R q0PW:S R qP W * R qP W: R qP 4 R q 0P6Wn:R! 00 R q0P"W*Y R q 1PW J:  R q1P b8`9]8`4ꜲO-@Q` MP U|t㾋0*SP *0 00S 00SQ*X * R XqU "XR Vs Zp  RYm Y YC VASP9 Z7: 0fRP P.q PP PEU%: R R qP R qP u R qP EU*` V Ѝ0S Q +*U r(R ^*\P -0*SPn(P  pYP VP  R p f Pj PJ VX P R pPZP R pPN PPz R pPE PJ VR\\74 V R p PfPP ` VU  ` V R zpP `R qpP0`lQ *Xp0`P[P0`UQ X_ cꜲE-M0`@ P 000p'SS  d0P 7Q P@@0p'SSS@Ѝ@O-MPϋ0@P2*pp`Q! \Q( [Q\)^1 ]PP  d07QP@@Q 0@Ѝ Q @ VSB WS> Y S: P᫊P< d06Z'P' 0@ P\ 0P  0pPp  p@0S0ЍP  nP@ @@`SppS``0S  R 0RpR`S SpS`0xG-0M`0 0P( 0pW8 \R: @1PA0 d060S9P04 T` S`Q  S   SW`00Ѝ `R\R $R@P00@-D@t8 844 0\000 == l`1Pp@-L PUI DADa,P/UB R 0"0 R.(@᫉P 吺0 @r0 p@3 0R  R  (@኉PT0 Hp,P PptxxhXp@-P`` R@ Pl30U0p, 0 0S0U0phXO-QlM@P + 0S( @ɇ0 0P R<pTk 0 SR`` \Y`@PSK pW0I^2*&lЍ AR R@ X= `VpPJp'`PY & &Qp `Vp W'p@PW0 \0 K'0P*H00S0 :'0%0!PPʈ@PPX szp+ \T mzp$ X\ (3T*[4h \(R  @1*S 0 - *R0 * R    R *R * R ( 0l 0Y \[ 0S S] S$( L8, R@@{P60 dz20S4P0) TP SPQ  S   SWP00Ѝ0@T P0@-@P0@T' G-0M 00P$⨄@TQ "PQ T p P`5 T@@Q. P4 d02 R&P& 0 @P \ 0P 0 P  @PT Ѝ @@@PP i#p@-`P @@PT 0 0QP\@PTpO-0M@P 00V #h"P[ |Z z3 0 PS p`: S0@SSC Z S @oP5 d0n1Q'P' 0 @P\ 0P 0 P  P0S @ Ѝ @@PS "@xG-M*\*\@\@`p(P0S6 J P IPA  D06 *S*S@S]PI  I ЍP 0 D @' OY y 3V R`  @S*S]^  I" 00Cp Y d^8@-@P PG"y8O-PMЍ0S Sc P6^ 0S %QPVUEPPP o 0S\e0pSp9 R6 pRRpp R 0S  SSpR0 RRpP00  J Z ` P @Y 0S0eP Pዂ`X{YWk  @@JZ  P ğ Rv T}@@8c-,|]Pcԓ夀MX 夠GZ @AT ;#P9U pß`3V \p-W '`VKP R D    +0thXH-pd` RM 0QA <*0dK  hX8@-@TP@ᖰ8@ᐰ8*P0@- @S  @ @ @q@p@@j@G-`P@P p0 Z  ӥ`VpP Q` h` @B~@-~  O-`PS0 S. ~S, 'S\S# "S! ;~P 0 d:*0SP@@0SW  |@Ѝp@ ;/PP@ @֭ @ @E-`P MP@ @T= Ạ\{| 0@=SPi q|"00p^! X5 J+ 0Ǭ[xP/ U  xrP ЍXP >F`P ,0& P 0㔬[HPU^  Q`V3 E`V  l1P:PP0J0+P U p PY7\(P{pWx ^ | `[D#V 0D ^ x`  `C\ p L`PP!pM` - M!0 0 Ѝ- M!0 0 ЍO-@|Mp,Ppl $0k Q 0S5 ( $0S X4Q 0S0夠`LTJ <TG =T 0  (^l.=0S`T ~T< \T0 Sp 00@0@00 -p T@ tP@t04 c0 pPW bs @ 0GS *R  0S * 0S:pTp`a$TO 'T?pITpXpt@TP0ppp0H 'RR tP00 d 0SP@p@p 'RR ^0S@Q@ @0@^=  p0`@ T00嘀!5 0p☀P 0KP X ,Q ^  X @勣T| X ^ pW  0fSp, b `  |r 0fSp   `pp!*0ʟ P ,0P p W00@ A 0 z]@X  0\000(Sy u 0 \ (p :W0g9~^c  _ \r@Tp, 0W RC 00Q00S< pXPU 0R^Qd Ѝ  PQRO0000X0S000 Ɍ   Ɍ^pw R ~^ :0(P0ǟ:0S" (pW  $\  q R ~^ :00RS &Q $p W (Pl=0S$ D  ⿓ 0:0pP \7 Q4tP ~R p@@Q(pW,5$PrP@d04 c0pPWpUqp@0 GW R   0W  0 W x0P ^@P @rP00C0rP@l04 c00SpP qp @ 0GS *R 0S* 0S:0 0~ls0Szh3<T \"00P@@a @ Qv@@0Xꌀp4 c0p1pPWpp0 GS @*R 0S * 0S:p 0qP\0pp0 S i【  Rpp @ 0`0 0CS0zPᆗ@708ep@p($qPZi00000 0900 0 000 090<X: ;@ma0pp@ @T0 0Q 0  xXHx,LP̰TtT0ppp# p@`0Pp< P9 ˠW% 0Sf   ` R ,^ , PQ 0S @0po@T@04| c0pPWpo\0 G0@0S *R 0S * 0S:p  dop@ p{z p%  X :pW\-P>T0l  L@@ LD<@ݒ82o @8pH  0㣹D0pW D8^8`s Pl\n3  hpp8 0T sPx j<Ú,qF@7p:07@0L00 p-) p&6n @p0x03~^?J P:@T p`00`P ~ @00 pᇟ Rn | y@ y8R<P@$hRD$P)<KP< R 78FP PzP8.X8p@``h @ʀ% | my  dyO-P$Mb c(PP@> UQ P ppDH0   0 0@TTP6 P'0S 0S w   P0PP P0R0twl@p @ ^ Pp @P % 0 PP0 P< P @- 0 @T ^ MW@aWVp/ @0`   \oPe T6P 00@ P0۞ٞ%!0 ўW Q  WpP @ şX 3p\' p@T# xUteWhhheXPP8/PP(5Xm  @T啞00$Ѝ  z0 P  {0x P0mkD$000FHğT^* ` `{4P` ;0S P Ɠ`V0Sv 0寕0 pP P00|T#^`0SVoß@p@Wp,! p"0``@mU+ @0P !0P !pPR WP 0SR ړ 0h0SPO =V`AUTp םV Pp Vp.   @@[ ` @aUc |TP] 0S 屝T @ pWv U s pal0p0 0S!P# Q``@{P崐ԠԀ`@PQ`0SpWP oDp |Fw@T@ꜰ̯̰ Ll THp|$@-@PMppЍ0S `Pk  P0, Pp0W <`W P *W 0S 0' ㅒpꜰp@-@M@`T0P 0P PЍp0@; @ 4̰ 0p@-S@@p0S  0PP T T@@`C@Ɯp8@p@-`PMPPЍp0S @  J ik  0, PP U 0S 30ꜰ8@-0P@80S PP @|8p@-PPM@@Ѝp0S `` 'kD  0, [@P l0Pp@-@p0S PP Z@JT p@8@-0P@80S PP O@580P@-@0S L@  @P 0S 0蜰8@-0P@80S PP @8 p@-0P @T p@ip@- $@000P@[ꜰ 00@-P MU 0# 0 P@͛T @P@ Ѝ0QO-PM`@Ѝ 0p U【p 0/SpPp? ^j{   p@p0/R"p/Qq  P Z 0#Sp` %Sp` `Y \ 0TY@P yT B >`p@Z kU ge@@0 X 7@P @ 0 #[0?  0 00@T@*@ p   @ %T Wy`P P  .  \P `P Pu 8 Po 0i 0-@TO-QMP`8p@Ѝ  0p  @^U【j ,Us ~U Va e i`PY  PY !! !0 @ n 6@U pP@7 0 IOYG F@T@*@   @ᆚT Xp &Y@ P T  Ip{@PV 0^S0 0@`V 0,S0 0〠` iV 0~S0  0`s,@E-QM@p`8PpЍ 04p #W 0k %Spl ph 2@ #Xp$4$#p$pT   F. 0 P 0@00PG +`V  0P  pW <p`P  0PipљW xXpP W  00p#Spp@ 0S 3`O-M00Pp@D PWL@0 S`]Y  R ; T 00SW @T\d 00@[ X^(  m-W+W TE "h?pjPm . P d@ЍS   Q P 1  ! 1@0 S` 0 @  '00S Q@gp@@ǀ0+0@O-@@M#QP$ 40@@ `@/0X 0R@  CR6  0R ~R 8@(p#W\`(QVY-X?XF #XD XR P  }R pE0:R0ha2 XBp8@(p1!P #Q?Q @Q *Q-0Edg 0@ !\000u 0}X 08@0(p#W !W 0G P `0 S8 V  R ` #S?S] @S[ *S ` #R @R Vp 00 S}Rp 0 L R[ V 40` $ ` 0SD0H0p @Hӗ0W0D0p-P(P DQ r3}XX``0 @0^80SYU-XF ?%X +XA #XFV W^ [뽍HpFp0`p  _S`(+0N 0R@-Q?Q7 #Q48L @(R` #Ru0pSs  R}[L p` qUxTV W t Ѝᛆ`PE `Jp0 ` 1_S/ 0C Q,#S?S`` ` @R# *R  R2$4Q^P#hP.[,,P(NP #` $ 0%p0  S*R@Rp X400LS/R }X 8@([^R,RL  8@ ( O?X }X5 =XD\ Y +X VK L 0$PV W P U  U eUP 0S^$ ND[P KV W 1[  Pa i Pf@S*SQD1`V pW` [`  R` ^` \` P` Q` $`V` `00S 0`SZ0V0 \pp`pK똰ᆮs4PXDLxT P$ԯP000C SPB*P 0Sx0`V pW` Q` [`  R` ^` \` P` $`V` `10S 0`SW =X [?X  +X $4 R pYW Ȑ4$0p[$E PPu pvR   R!`CVV66::66666666 :6666666666666666692ŭPU0 ^ `py*yP 3P PU pW ^ \ Q [ R $P S0S 0SቭPcჭP$4  \  RȰ  [  W -Vu 4Ȑ$0+ j W0 $@뵉T@? R<\97 ņP  mu%)P;IP P dPbU Rb P2`p^0D\ ? ><?@@ ,0㣯ʿ 0[Z "R0" 0""Z0"R0D^Z Y' 5Tbq @:@@PUb PfDYh ؃Z D4PPXr@?l?@'0S( 0S0# 0S0 0S0 0S0 0S0 0S0 0S0 $Z0 0   R 0R"ʿ0smVcP8\ [ QaL(4吐00؃@$" X, V-(P8 U $ Y LX &P U\ U 00QUQ S  R P0UY  $ ;UP ŒbPd`唠b(4PZ 0S X0 PU0 D0(P RX` 0SD bPP 0  0 PUPPP0S/ (X, bP$0 0 e0SPP 0S bP0 0 e0S~PP PP84Pa` SE ~bP@0 e 0{\P1 0IS/ Y- fbP&00 h 0c R9P IP PbP0 h 0MQ1P  KPDXP $$U L\\ PnPR 0-$U`](8 KPV- P kF=[0oPp %PP D^_U`pF 0 ``@^*^]\ @n @0 ]KPf \c ,aPPm `Vj pW`p\ `V `p P 0 D @ `,PyaPU pW Q`p$_P`Pb A8%XaPX P`p*$ 0Rm000,8 ʿ/ؠG`pD$L%따 @R@ $400P00S00\00D呆@ |pPP ( [ːP Q [V 0S`pS R`e@R`pa^f`Y`p7 0IPVE'T`p) (njR 08Pf 0Sc  Ra X^ 8Y^$`pMX( \F Q [`p@ `p;`p $ !y`p&@0@ʿС 0 C PSC`pPU [ 0S  R`p `p Diw`pp`d^T$XO-Pp\M`! A@Pp倐儰ZRq\NMXQNMMMPM@PMM@QMMNNNNNNNNNNMMMMMDOPOMMMMMMMMMMMMMMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMLM 0P:P`V PS P P  UP HQLp Th   P Y _YW2I@P 0S[p^`X$` `Pp9p ᠨPp`09`ᖨPp0S pPpp``\Ѝt)tɟ0A0p03X0S P` pW ixPp`0` 9OpPG [ 00Y00`Pp0 X !LPP &pለ``H H RP^D8\ (``,hpP 00S [ \7  Y Q R` ` ỎPp0wXp p! LPP (P pV ?P 4Zn Pp`0YPp`0S6P Q `V pW [ \ ^ R $P 0S 0SDv`V p0$ƟS ^f eP HX00`VPp0 z `Vg` CsPp `0Q0S@T00@T0@$`UTT`VǾ ş4`$V`` [Pp0ШP 0 P Di  0[ pW  D`Pp\X" `Pp RKP0`30S $@`TTU`Vp$!0TTUV0`PpxPp`0nPpom Cb\ =@L0)S PpV[ $0*`TT0U`Vph00L @0RD07@8 0p(P` @0@(S` )Sl 'SI \S- "S% ]P 0 h@0  RbP UP P@` mp LCS  @P ^]P 0 h@0[ Q @0@'SS @] h 0P > QP0`V* P@`R(@,p Ry 꼰TP$ԯ HİXd^A- M`Pp0@P8V Z x[$@(`0 @@@ @@Tm  Ѝ!P,kP? pWM 0 9@MS`V- + `fp|@P' 0S 5p`,0@`p` ! 0P0R@@Tp R `p`pR00S P\g`$p8\'pW` 0p`pd^E- p`dPU. "@5 ᴋ 0rTP 00@ SQ pQ  ?P@zP ꍋ 0KX@-@@Dp@-0PSPp$!Q P  @ ``.PP/U+ hZ./0P0K`P .R SrZp@/PP  `D0}/P<[ZxPT<=`@-0S P Q @PP T0P/[@-@0S@A-@P`P@pQ)  N0S cP Z(0V /R   pYYPTP/0S/ #0S/0S/$  #0S0C/@-@P`0S0Sp QU 6/PPU0pS@-@@G-@Pp0SQ#0QU 7/VP W`VP0 Q8@-@ rYTP mY0T00DS  R 0S 0S8 QY@@O-`QP@X Y  p  0pp#0SA 0@T P@ R0 \PZHG-PQ@, = Xp  0pp#0SA `V`V \0SzPY`X ` p00 `0S@-@Q MP'   pW` 0``'pWApqX0  `0P0 ЍP  @O-PM` G  R > p  A 1T0. 00wX PQpX0S V 6/ p@0T  SXXP2QXn 0 R  Ѝ0p-`V% 0@PFP0 00A Q P0 00A  !P0 00A0 00Ap/p@-d`0S@Q@\Q XV RP Op0@-xP@lM1 70P 1 lЍ0HP O-M[P W R0Si@@Q`q1` R  $PuZphY) ,"0Y   %С޳PA$Z=1Y 0@ ~PZ  눡P  p弳P$P` W n0 b3@Q[0  ޫ ЍW 0SQYSࠣ^  [b  С R `h !,40 傺$ =b zg̖O-tMz,X`p@H0 SPo PX@@Z 0Si PX@ 4@P^# PX@' R oP  P @P0 X  tЍ TP PX@P V`PP V aR@ Vx@ 0Rd    !P P@`8@-IE8P[ zV $@/0 0 8Q p@-0Mp0PP`H x@P; 0S.  \S8 ?S%S1 0S ?S%S) 0S R \S  ?S%S Q 0S R \S0 S{x@PЍpP  8士`P @P `0( 0S/@- 0-t M⃫P zP R   ,aP ЍL0B/ /} 00 !/0/0/0@/0! !/0/ @-@ 0 !\00 @  @P0 /   8pܞ}01/$ P/P/ P/8@-Q`0 !0P0 p@Q, 6/@1 Q& 6/@AT 1@1@AT`0\  ! <0S101I F orop@-PP@1`  VA0@0($!1 0a1p1,@-@ 0 !PAPp@-@ BPCPP @TTP1Bp" p@P1@ @TTP \`\!R 01 \01 8PAP8@-@ BPCPA0DSP1  1 R   8@PڔP188 l8`P`0\  !R P010 81p@-!M @QPP  Pލp` !-\Q\aJTgL1  O,0 0S@,CPAP  T5 M`0!0P  QP ^ 0` b/P=T qh@b/=q@T! qf8 ,,8@- Q0S8@CPuP8 <Q0S/BhHt0@-AQ@T AT[P0P  \ R0^ @@UqT@-A`QQ`0MV00 ЍpyS P`P 0*qP0 Q 0S Ph0P000L0  M 4 e(q 0`A-`p`3PAP@P BPCP a1q! R. R  ?S\A5SRV0SAl B!S>HA54 !/1Q0188}CBACP0P/ ^l2O-!CMRt BRb嬲@㈀p P @R`3@ATP`Y 0S qqq -qT~ 0SK SI MR +e =L  Pq @R` bq`qmq qTV 0S7 S5 gMmRD d L  @pATP`Cߍ ] P ]f &p x] Pl o]N ӳ&pS4O$0 8A-P@1@Pʜ1S S S0q Qp`! \0S PS p< *]Ay$P$@o8 (@-x01 @ P AP BP P7 O-M`vP @U@TЍ 0☑@P #P   p00@PW @ 0S SS3 X P @@PPZ@ pW 0S SS XPP PX ]P [\ PX MP [PP(@-mQpA llQll0 !!! !!! `0ASqaT D ODDP 0D0F  A`V7x`0 01 p R0S <`# < <<0\0<880 pR B /(0 R Q/Q\0 R PQ/@0 P/0S/Q/Q 0/404 0p1/ R B /8@-P0S@ A0 S R\葛P 8  8<zP 00008谲l0@-0MSЍAT  `0  r0孆8@-@P8PP  0!80P@-@@ |0P@-H S R P @@{Q 008@-@0P0O U80 Q S 8R 0 S80 SP8A-pM@ {P,0P PHP0# P RPPOlpO0T` U  aPpЍ{`0@- MP@((0$ @P K Ѝ0@-7{P@PG-@@< 4QT0P71 R8 0apP! Q  Q  Q ,p pY 0 qO  V900S@Z S   =80 R TU0p@-aP @1S t P  XZް00^  0S@ {p {p@ {P 80Z~@lQ,@-p0 R dQX0 P 0PPpxpQE-q`0S>Q0 S R ᢱ zP4P0 S Z! S@P  0 0 ႱErP HY@x갲,8@-0S8@ P P8蘲,8@-0S8@ P P8蘲8@-@0P0MP8輲08@-0S8 @ P ^P8蘲08@-0S8 @ P P8蘲<8@-0S8(@( PP  DP8蘲 0P/ᘲ0@-(@ M P"00P Ѝ0輲8@-@PN 0 48蘲@-`pN(P(0 @ `@蘲0 ~ 0S/00J꘲P@-0@ 0S P蘲p@-lP`@Tp/@T 0S R`Pp@p蘲A-Pp@T`S 3/ @T 000SW  R:PA @T蘲!0A<SC`ttttttttX`tttttttttttttttttttX`ttttttttttttttttttttttttttXXX/(P//0/U@-P@ ?M  R R `  0P\p \R x  0 Rn RU  /R V^  $BX\ ꬓ0p R000  R000Sp0O-@M+ PPa U 0RV 0 S P P P0 PU  X \ЍU`PoL`) opP `Z0p0< 0Rp P 2/ npP q` 'L0PU8@-4@P0SU0P8 0 8Up@-0P.S x x@`V!``P P  1P pp0S .SPUO-0M 00@\ p`K0S3 T PP[MP3 d0ZQ%P% 0 @PQ 0P 0P @0S0 Ѝ @@@A-`M@` `0 pPS> ?S@ !S -*S +S 0(SЍ[S @S L@DP  d0QP@@0@`0\S ]SV0S0S @ A-0PS R XqP' @p`01p`P PpPV R00  RAqAk0U8@-P@ u 3 0Q@/PVU XU P\ 0S 8 PD8U0 /ᤲp@-FMP0`1ii -i @Fߍp0ꤲ@- 00p@- @Rp P   0TSpPl0l PhhhPPPPPp@.iCP ꤲԵеصX0 R/ꤲ@-"h0@-X@0S ^^PK44 ((0(( XԵصе8@-h1@T @ B 0S8DD@Q^0N€ 0 YP +^0S Q  hDP5 RP\0PR ^ T OP xQh hPF A0 *ꤲ 8XԵصе$̖Ж, 0R   S/ꤲp@-0MSЍpPpDhP DdP 0dP $dP 0dP <cP HcP TcP `cP lcPs xcPc |cPR hcPA TcP1 @cP! ,cP CP P00g P00g PPg P @0g P00g P00gxs PxPglh Pl @0g`] Pw`h0d0tgoTQ PfT\0X0hg^HE PUHP]gN<: PE< @0Rg>0/ P508040Fg-$# P$$,0(0:g PP/g P @0$g P``gꤲUG-FM0S Fߍ茀@"R 1kgigvg sgpg$mg0jg<ggHdgTag`^gl[gxXgUgRgOgLgIg@Eg p`衟PH A PP# @T; P f0Q0SE P0S S  PfzP f0 P 0S/ P0S S  @fT00o {fP0US P0S S  hf cfK \fD  Uf=ꤲpU0U@-p@0SdfX PfHfP , @臲8ܞ0=S) <S>S R! =S!S -S /0S \tS"  eR eSg0B RT/ =RQ/ R =RfC0 S( $/ g0B0S/0-S /Q GB03St/@-P 00eȲ@- R @-@ R - tMG0B3S3 `HīHlH8 ܪtP8 tЍ|3p3p3 ᬓPhkP  ?QP`uP ᔓP#R㷓p3 დP  QfqPP nP  eP0#Š  \P0 \ OP* R DP0 ^z 9Pt* Ro .p3i (Pc  Q^ PXPR PLPHPG0SC  qP>  ^9 P3 0 ^-Q0@-@ M!1Q-Q Ѝ0PGA 3PtP tQ0 S1S1  jP !01Ȳ\PP>\<\  RPU2pP !\0 tUC eRN eU p RVN Ÿ 0R S0 *p3p=RPUlR` nRY gR p@]Pp=RUVQ l!l^ P *PpgBP񟗻꘳ܱܱܱܱܱp\fU$ qU p@- 0Rgp3p p@ p@ p@ p@ p@ p@ p@0\p9Pp蜲A-@唁q0Q0=S >S<S R !S -S `VP !0.!010S !0!0=S $ OPȲ\A-@AaQqP+-P !0!S( (S1` )R,11PQa\  a\o\R1# R`P1111Q唁 X p34 8OaQ@P Ȳ\G-$B吡Q Uzap!W20SPP\n0 1  !!P RP0QP UX b0!P QP b0!P R Qp3(WQ( RP UQ71QU6 )^Q01 Nqa1Q0 S-W PWQ P GPGA0 3S L t0S G8QQ$  NȲ@|@-ld0!R@-P a^Q !TP@@Ȳ@-`0!R@-P o^Q !@@@Ȳ@-!1S@Ȳ@-M`P 1Ѝ!0S [P@ @\A_0CPкl0!\? XA@L1Q < N} A! @ AR0 p3`@TN 1S ]Q!0S Rt@A^0L@S \! p3Z`BU` вȲ@-M\$  0Ѝhp@- |@MPh ]TpT MD M4 ML$ Mp@F0L@-@@A-P0S@0S 0VB0pW@ ` P1S  0SP `VT ȗ 0cꈴ0 00R/@-,@P vm00@7ꈴDV8@-L@Q8 PP XV708舴DV@-$0Q P舴O-MP봔`AA0p 0 Q0  @ [@P* @0Q" X Q Q \Q 'Q"Q@0S \S@ SK0   @0QW ypg V 2002S`0 mA I  R  0Sxr0pQp 0 \ㄠ0 PSC X^> [P:  2@ /0V 2 2R` 0#A0 TWX @0T S S0 0O0DK0 0 Z {0S0 @d V 20S`0 @ @ P0  Q | Q Qpv  pQ Q Q P \R 'R"R 0S \S R  0S[ pX RX@% Ѝ舴@H@-@P@@$@-0S P舴@-@0S$舴A-aP0pS @P i@```_P Q Q`` v@@Rq@Kj@00B \ R R  :Y@v @A6ꈴDV@-@PPp!0 `S5/P `PP - /A  \ \ `WV ؠ``pp S R a  P0-@P0/!  0R 0R QP@-`Pp?U@` ? 0 00C-PP`1  000R00S'V0R @ !  0 SR!  @0T  @S0  @- ?` p@a Ѐ@-`@p0T`P0  0` 0 0 @Wa p pC-`PP  ؀ @0RP0  a 0   0 @PpO-PMT !M  pY+ P@  T5 `V [5  0SCV[ P 0Y 9 P pYX00Ѝ@S>$V[ P R@@>`>00@-@PP ;@88@-PP8 0R0 @0S 0080PpO-@pЁ @@Q@T` V @ VQ\ @ʿ ` @ @T P@ V@ X @T P@@ P @T  R@PA @P @ @@ C-@P`p P  t R!   0!0 0` QV Q SRWU ?>\!` p0  !C-@Q MP `p 0@` pT Ѝ@-@Pg@p@-PPp0SPp @S 0`S I` @P@-@P@:O-P$MP$Ѝ! =P(0 pSp`u `@ 0EP ;Y Q  R  \  Zx ^u 0S Q   0SS[  YZ `VW \ ^ k 0] =Z `  P \ ^ R` Q `Z  p0SpWd  >=P0)Sq @Pj@S)= P[ _YZA-pP`0 S0P @S` X  ==0 @SPQ00A-pP! 0 @S Pᙇ`/dcPP @PUQAv&p@-PP0p! 0 @S `dc @Q`P0 R p@W&8@-PP80SP8 @S 堷0 @Sp@-PPp0SPp @S 0`S ` @Pp@-PPp0SPp @S շ0`S ` @Pp@-PPp0SPp @S 0`S ` @PPE-@ MPpP Ѝ0S !  `P  2Q  `R @@#T 7@ᣫP PU\ 00 Pn( 4P;@;@,PE-` MpPP Ѝ0S !  @P  0Q 6 @R @\@#T ۳@GP PU\ 00 uP 4iP㷳@;@,O-P M`pЃ<@ 0S` ЍС ؠZ S РZ РZ S`pV  ` pV S \@P' Z80S T# `lT _@˪P QP ` `  `kC@;@,@-` Mp.; G`@P`EᕾX `P`pnl0S  Ѝ p@-P`@P  (ғp@O0V  p@ȓjXp@-P`@P  (库p@70V  p@谓jXE-0M`@ 00P p 0CQP p`@0S [SP ]SPEU )<P@0SЍ@pGE-@[PὙ`P pe0P]P m:T[``Zpgp|T`Z8@-PP @T 0 8@8p@-M@ P@Ѝp 0@S*S]Q0DP @ PU *Pz@~k&P0b`P᰺`L@~d^O- MP@  Q+ 0*S  *S@S0]S X00[ 0D @R `pV +[- ЍX R   TK [1@ @ ] AP ^ 0D0 [0 C˛[L@   0P 0D@ @ M`P 0*Sj ᡛ`PObZ``@Ჯ0 b0 _p@-[Pᣘ@P ``][00Pp P]RQP \ \  0 S S  ^ ^ Q Q0P pp@-P`o 0p03]R0S400@S*S@T @@@ P P p 0R!Pp.pp` 4D LIBp8 @)D 0 =Bp `tO-P M`p ` 0`pQ @PZ  0y03PY+\( {PTh0S S S S }S@U"U `U@p {R00'U0S U@p@P{P }P  Y RI }^,P}^.S<.P? q3P0 d 0oZ} @\(Q0D D0D@1@O p@pI@DQ 0ZS S S S]0S S  < 00P}Q00STO-P$MP Q 1. 10S@q @l R[Be@pp0`q`@y1   0   Q7X E@a1 }0x ` V`"2p L1 h0`c!`>1 Z  U @ P @00{@QA r $Ѝ$ЍO~$ЍOzO-|M\`@xPpp%` {0] }0P tpSPt0t0 t 0t t0{Yp |Ѝt` `}0t`2P t t\ f`p0L\`TP R \R ,R  32Pp l 01QP p0p0 RPP `e    \ ^ @;UP :l0  +S-S0  0l ,Sl0 S R .R  X 00SX \ V Af ` @ 00S  V -S+ ` R R00S^`R -S ``hV`f Q[ `  X  Rk?00X00Sk (p,Pp P@%QU U /hhh  T^T  [ R \ !p0p0pQ1Pp n0O\p00p0p 0p0 /x!0 8< d 8`00Hp @p`  1PW d n80@TNPH d@d@WO ,0 d p_V@. 7Z0`0 !J S  P 0 S 0 S!  0 1@ 0`Pd@d@d@0@d@p @pyɄt  @rpᾄ500SR  0Y R0h h0 10 1,P@(pHFV1y  # X.Xl .R& 0Pt r8 0屐  Y? < 0l"[` ` 0".Ql00S 0l `Ql0 TXO-ttpt`tPt@ M0d d 0 0 Ѝ`tTO-Q$M`PP $ЍOe. 0R0p0U0F 0 @ 0 V!{3P00Sy Rv Qs R pQ R0 RU@V0DZ [Z  RW  pp0-0p{00ZI e . 0  y K -p6@ f0  k}00@  -p!V s0Z  - 5 UQ}@$Ѝ$ЍO `A-@.P/PU 0P P`pp`PE 0N 00R/0 ,0(( P /UT0  /U0S \R0 &R 0 R/00/@- =@@-PU@- 0S U܋E-@H M0S/ 8!Q+,PU$qB PP" 0S`)  0- 0@` @FT 9 0  t ЍE @\^Q\P P Q㸰崰 0@PH"SH ` Vb QCPp` 0 ^J 0PV Y`J\40VPX01pW@ \QP  @0 ̿00! QpWp ?# a ` dwp PpvpPt`@`V 0 R `V0  `V000a꘴@-@ 0S=蘴p@-TAQP&P $\ 0  {S  < X0S u }PPPPp`P  PP `06`V pP{ ꘴L@-A,0,, $$0 `I 4GF8@-(@P> 0S  8 V%G-@hMP$~PE  JPL ᩿+`Pk  RpH  P@P.^0S &B`>oP= wQ/X) hЍ`~P d$!*P 1_p`ʶ@`PpPp GP E  pW ᩶p᥶᣶NpvpP ᗶn`PpO-0Q@ğMP0Jt` Q Q  $ R0C Q Q B` "Q'QA pQ)`0`S^ Ve PfaRB Q Q @`P0C Q Q`0S*p 0RZß `Q[ `x~P 0&S V[ >R|S $R{S PCzp  ` Q Q0 S`J Q Q0CZ:S C Q Q0B `RJ Q Q `Z:V"TP x^" 0`^Ѝ<"BP 0娡P `R` "3Pr `q<R>Rm PP1 \P ǵ됱QW 0 h!內T0 L!0| R R 0 S S !0 k  V Z\ R 0! Y ስP  A0 P ~ Z YB P 0 0 FغWp<d@-,E M0S Ѝs%uP  5PeUş                  |ݳx tٳp lճh dѳ` \ͳX TɳP LųH D@ <彳8 4平0 ,嵳( $屳  孳 㩳 $㉰#^ㅰH#ば`<#P{ p `picP p p`P 5d#{bT#/^L#/Z0~ (0GPt $Pq #~I"@E"@A"$="$9x"!5p"!1h"g-`"*)Xx"g%0  T0P: T"P7 L2LHHŸDD20" 0"v$!@!\ĥ!*!=㼥! c1!1iR<L! 㡥4!娯$墥h垥\꘴ЖȖ@kcj(4f4dHj\$jlcLc0a`Z,  x`$]8X`X]l8`]`]_]<^(x]<h]P\hZLkDcTs\{`I 4GF|ZdX^ V $LU|4O-p@WPg "Wu 'WppW``@X~TW' 1>W^ W u@Z ჳT``VpWp`$P@XpW`00Fl t@` 0SP @P`\\S 0P\ 0SE @ {P 00T  {P "Q`pp` u@|0Sp l `V `p0~S?P 00pp!zP`p`pxT00@-D0 MRSP@ Q\  Ѝ0@H . Pu Ѝ0@诺꘴@-M_00@P R ^}ᚺ{ЍO-pA MlQ|P0S1 E 2hPD .hPJ *hPP &hPV "hPP Q xAP k᧱LhPPp\p,A P ΩXwᔱ Pp^pp@0Q R d'Q PU YQ ^ O`0Q R E8Q PU ; P\A-Pp`0TS 0AS7 CSu MSO NS^U^ @ `CRP cW  '@ P SW ڱ P @T @BP :W[ ±RQT P@@Q @ET80S \ @$TS IRA0S Q@0TS? OS0S R@T|\:h ` snp{@G\3 s=00S PTcl@0S 0SFU^@  vHpŰ 0r/P gPp帰 rjꌵ ,p@-,P,@ffp@U@-@ <@P 5(@()\@-30P R T @z<=-lM ;P 0* R  RICAlЍR 820P  @@ @@Qp@-P@  ᝰp@دpE-0`~S@PP `q0S .RC  _U PA @P ` `   P ا @ ` V U @ çQ Hg ᄯL 43K2P ᥧ꠵<=RO-MA  1 P1  Ѝ 0Sd \ژ0  L S  R 0 S P0 SPPM34pP0$ pp ; e|p`P) | Q% | 0PP JM[ 0 R  q P >p  ` P0   00f0 e ꠵<=4@-@-0O-0MPp`2@P`U P Ꮿˮ0ЍT!@僯D ဠ<:@*P* Q;@T5  0@P  զ 0S 0P P 0Ȧ 0Ħ|@Ph0@S  P0 岦 00꠵<=p@-@PP2[P Q 0S;p@W p@q4@$A-P4[@P 0p`P2P" p`@I2P3W@T ^``V  0ݴ$ ;@O@Pp` hP\ R 0S ᒴ8A4TH@-P0P0- P H A Q  R  q30 S0/6 @-mt t@`Qi500p២`P?U` P`?H@-00 50  贵dO- R M  @;PPo  ;`؁ `5`00zmTP0  5y3T[0pp U(00\q\`0 Q T0Y/T@@YY!   : Ѝ 5p0T@@YY `   : Pz5 0  :PP  ko괵d\A-`PPwq Q 0S>@3 R8 tX@`P oT7 0S$!P \ x^p   R@ D0S0pTD `^ꀐ\8 P.8pz  jPd -P0S +PVT2d @ @2Ӣ @ T  `<$ ϻH kpP- Y* Q  \  > u7X W0 1 夢1Y Sg 7B$!  7Sᒻp- S ဢp& ꜀K  *6P  " 6pP Q w apꤢmP`94K/P K ?QPc P2 Z r, X2f R2` L2Z F2TpWf <p6 002>M   嗪0MЈ ϩ @1, 6O(9(s6n6(0p \|  6pPpAK 5P0* R  \  0 -P{B6 ppZH,V̖دЖTcp@-P@ l`P k;00TP ?T` @T `P Ipd\00/@- @2/0000/00/00/00/,P R / 0P/R /@-Pp@T( @@aV]0 DS  R 0S 0!S! 1  ]0 Q@-$Q@]PU? 10E ` Rp    !Q0# V ^    !Q0 ` V `0 1^ 00 1Q0 !0  pbb@-$Q@f]PU? 10E ` Rp    !Q0# V ^    !Q0 ` V `0 1^ 00 1Q0 !0  pbbE-Q@]pW6P0GP 0R` !0\  U PPUPQ 0\  PZ !0^0\ !00  0`bbO- M1/@PV PUP`SP0`S 0\F p屨p  Z,[  pاZ周ɧ  僨p0彧Z 0` Ѝ0@v\`@-l<@-@>@-`<@-H<8@-@W\P ]P008G-PG ]D\P= PU? ZJ @`p0 P( @p`Da0P ;X0@Pp`U -J0pZ@` PRJ !G[@-0  P 08@-@[PA]P 0088@-@[P 3|]P 0088@-P[@{P j]@08@-P4p`[@p`V]@ 00O- MV`Pe PU@Pc@pPW0[ E0pP 廦0Zp9X P m 娦0Zp %`~0嚦Z0pQ On劦0 RpZp  0PP Ѝ0`6[@0@-@<=W8;W49W07W,5W(3WT 0  TE-pM 0`[PVP@ PV000 0Q<[8 0P  R    Q[1 PQ 0sQ[PPPU 0ЍVRP    0  0KQ8[> WTE-@Pl/w-TpI `V9 ~em-`\/g-PHQ!@HT 0SX @T 0S@T S 0R08/C-P Ke:-`(/3-"/--P,/&-`/ -Pp@-@Q`xPP h  \ 0S P3/p@诇 ?\0꼵O-@P MZ 0SW PT Q Yp  0Q \Q0 &QD 0!YppYQ`(蠟 P  00PQ R 1P  RPY^ P4Q0@ \A (@ Ѝ 0Ꜳ8@-P@U 00  0608P[0O-0M R@P c^ 0S0C YP  0S9ZNP@pP `^5 PZ@`V`V  Sr玤0PZ@p1 Qp ᯜЍpW   Y   , ᯥP v00pA-@`>PGR]@hs ~      !/  4 `@"ZPZXCpP ZPX |6pP ZPX L)pP YPX pP YPX@ pP YPX pP YPX  pP{ YPsX u \pPp YPfX j ,pPe YPYX _ pPZ YPLX T pPO YP?XI pPD YP2X> lpP9 xYP%X3 <pP. kYPX( pP# ^YP X pP QYPW spP DYPW |+p6YPYW  @p&YPYW  pYPYW  pYPYW rpXPsYWDVXVlVVVVVVVV W W4WHW\WpWW/0*+O-dMP` 刀q 0S@ Wp (P000 S (YX@eWTpW \ Q[ (x x0 \f0fXRX : XDOPo f0I 2 0 $ ߴܴ| ٴ GX嶴 4 HRO0P    *Z  !! ,S ^ Xf 0  0 d `Z`p 0 0S Q  \ ^   Z   pW"  P \͢ @0hS?   `Q   `)pW 0P p3 4 zWA ^ V0S, S ` ``0 SS \S X``0 SS A SS  0 SE S1ٙ W@ UV 0S[ 0S 3P Ǚ$Q  9TT`:@ Q@ U@T# 0S0 @ G ``P`uW@"VdЍ 0` S  8W00 & @@P@|P ~|\RP0 *Z U dRX *W@U2@3 Ox  cԛΡ 0ƋpP] ܕ #3 sUpP9 ^6 0S  R  PH 0P @P `0@Q1 Z V0@T0 0勡 Ơ000P0@P `!0 2Y V@\U  P 0غpx8|TO-Mp8FP" ``P[ 0@  00pW @嗘Ѝ /㙢P P[@@@ 0P/ 0PQ/ R/V@-(0Q P@-( $       8@-@(P P  ՠ  P ˠP 00P   P  P  ߟ$ P $՟$8@-@0@S0 P P P P P  P $P @L0@-Q 7@PP Η̗@-@P 000P/徦l@-@0S p@-@QP `Q 00ᄧ`P @p!@]p T ``P/@-0@P/00/ bĵPp@-P @T pᷗ@T$` &  apĵp@-Pᣗ@P p$`   apĵp@-aP/0PPS1A!x01@@A !01 @A$ |!|,|0tt148@llA< \d!dLP0\\1HD@T PAXt`0DD!DDD1h@dl p(00,AP\ PAU@ Q9 P zXP\- P PmXAU@0 1!p  (08@HPX`hpx 8@-P@BBp aP@ 80TPU :P PU 0P @6 PUT88p@-P`X@ (W W^0p@B\̖1A-`@PV``B|Bp @pP` \XPpup3@ Up@=\\ 0 =SS=S& ռP PUW P' ^P$ P @P W A pP @ p0HȽO-P M0S%Q E刅Qpp&B`hp@P'Bp4 P@(\ 񟗁xAJpPZPh2PYabd f hj lX$1nW$"pY50V0$3s  <PUZ! f@KL@@`@p@ @@}@zLxKv@t,sc ЍOQY  O P 8 0 r  ݍ    㽊 B  >X$1 ᶓP L p@  ᄐP  p ᐍpPN ypnᆍPK K PN QVQ0  xqxR  lFVQ%  TR  =VQ 0R  4V Q  R  +VQ  R  "VpW ]Rp%p0 _ vp XoptRVp  \K bp;<̖@Tp$@-0@P$0S '?еHȾ0@- M@P Ѝ0 ^ RT@_T   @(x 0  е0@- M@P Ѝ0 5 RT@_T   @(O 0  е8@-PP8L0@T8P0P $ P3/88C-` MHP0 0P, HP& @" HP   pW ! T ! RPH D`V6 U ! Ѝ@P !P  <  0p4  0@.WT`` P 0 U0 0 0P<U P  $T(4 p@-$@PP ^00p@Y@-`P`pP`@ HPV0ST  J`Th dA-`q00P?@`@?p LP PP' ~?paPU6 P\'U  \0S@@TU A`@LP u 3Q R TP 80PPܵ(H<=E-`P@T( V!`pP OW0S cT T ᵒ   @JpK@@Th4,lA-aP0@Sf -T`* KpW 0SJၒp`p t 3\ R V4 0$ S  X$S- S@@T@@@eJpT 'P V P @PTg`P'PP B'P)6`HP /@0+P (0@Hl4O-P M0S@h>p>p LP PP { Ѝ@@6|Ÿ|R`x"V0`!pSpVv 0-S R> P(ŸPUB PBP  Z^p R`P )P^ O`P P ZDOPPp4 p OP P(P SIᒑ P   `P0S R OPPp @XfY Td0P {Z fYuZ(8ܵT4L\H<//A-`@P= =p pP vP VP A`PP1@T UAVX \WdZOPP PN `PF,`, 9PUG @ H@-@ @4@-@ @*ة@-@ @ 0@-@ @@@-@ @ 긩P@- JC@-@PM" 0S -Q P fPP Ѝ R-\@T 0` R8@-@PT* 0S" 0-S P 1P  P U8U8Q-\@T 0P8٩`O-4M00@0$P(07XjX(pL7pI 0A@+S( 0, 07PpdX<$7p@T Xy$ϓP P"P[2P 000 S,0 P ,0 h`V R@%` 0 gF`VH ,  RVh 0 (X RX P@T\A4 R0 T( <(0DA>\:T(̎(3 0- T( <(0& #@-4ЍP@T   P 0Pf@TU]?`P,0@, 0?X  0G`H  +Q  LX?`P 0(  ,Qm 000o@v i@mY,DD (+ ) D 6N@00R\ Q  X  R(X P)R   (@ @,  @@DYv  000cZPX\  =R$^S 0SSD`4E`]@  qP l @л`0, (4 lj0@\8X, QQ  ~,  P ^c  0( 0\ F0`:0孻 G, wOPP P @JIPy AYq@`0^[`` , `Q |)@jC`0H 0ʻ, 9=P Z, ˑ lF0 0\060+QkGf=P 0 tJq3 1] RTdH@,$t40@-0S  @=꠭9O-C3MQPpK W  G B" SU `0W`` Yw [t ^ 0S D  0L[ Wa Q TLP ឈ PRUUk  TUZ Zh -\  b@T ``@`T dvP0S TS0 eS1 nS, ESp00SPU( Z 0-S @  ES{ I PR 0L0WЍ p@ @L@L#S00 ^  4T` `H̖$hG-P@l4Tt4pa0@) S"4<<<<<<<<<<< <<< @@@ Q@Q[q!0`S  PV P@6 Pa P@8q  P 0Q   X  Z ,Y , PU@P  `V 0=P T0\  0P8I,IH(bbVVP\@-P$ 0Pqa @$G-#M@<PL 0`H <P e  <P PY ;P 0Mp;P  AlPP)n/p# ppu:p S 5  S3  7/ R@#ލ`'`PP$ 0S Q@QPP ΍؀LYX*X S   NPPXPX @P$P =b: ( 4tßxP0P0 tU!9P lᢆ(#f, @@,@ PV %"@$0Sx(ŸP2P(PE0A0b/P0 W4 R/8,;0P  ^y 0S^ 0SN@L$ '7/0SB @A  $P9$^PPn, $]@p0b/0(0v d(XoPXP$'PW $ ,7/P~@ 9 ծ1 0/,-2ͮh ߯뼯 گ뷯$@~@3tl\i ȯ륯T`@@ (4DMlP8@T @-<@< 0QS $\\@ယHS8@-PVU @JPᬅ8 0 /UUA-4AP`ܟb  p*Q@嶟0S㰟U  W 0 " A|@0S tߟP ?X咟@ԟ<功0еXD 8Up@-M @p!`hQ `P@ PmNᄃ0 8ȯ0T@HH0@-PܝP,@;@VӝP @8@-Pދ-0@08E-p/@㜂`P/p cP lP aP hBP@`H2HpW@ ( RV0APpY Wm P W   pTO V@ U@Q `Va ^T } U? P$P ~@P ܂0S9 Q R1 X Aィ@{M@Lkሊ6pV ]@専@CCIT @_@,`d 8ȭ<0S/0 \ /0S/ \$8@-0SP$@ @嗠S@ 00@-0S @ *B\4p@-@X0S L`LP `R@C/Hp@  8\ЖXPG-MZ@ 0 00!R! Tj b P-U0` 00C S = P Ѝ\!lZ 0`匊Z P q ` 0S P/ `ZpGJY Z P `VpGZ`F0 SpP `WpJJ G^ ӊPU܋O-p@M@@@.0`PpS0 0-SP,-p' e@P 0P0 0 `0@0P ЍTp -^? Y W@ P#pT@W@ `=D`P T P m@ϲW0PUM `PI1巉qpP? T P`0`P`UPQ Y U@% oBXp P @0 S ^8 r{Po Z  Q 0 bW c 00S V0 堟p \ 00PV pUp` p @U& WP& @To(^qZbV^ 4\WA  R*  AB AUpGp WPV @i aF KP DT P L0PA PCPP嘚C勚 刚˚PpV& YpE婟| KA  A`^ yQ " A'0SP ᢟU\% !) I;P`R @1T@P P# ~V 0 +ph T \ ^ @U[ :DV꛽ RS1S0 0C00K@P|X@0T@ @07и`ЖU̖HЯp ܋|h@-0 @ @- @O-3PP. +@㘓p`+pd0@( S&&&&&&&&&&&&&&&&&`@pR P P`0v035 *ZU2 @P T  @3H`V5 ppP`f X 0 H@@BP PU"(PUP  Ÿ|@PTPT /P PP%XN čPVP' P P t`V X  P 0I PW  P rPDnPh|.3P P P qP U ~[Px \@d  0 T@,tH\H%T̖L%p@-Pp@ p, 1`~傆 BxO-M@* d*p mP sP dP < Ѝ00 0$0S $pPx(,$ ᬆ0X HP\`Q P p8 R gP  R0P 0 0 0S9 Q /R   F0'a?0S4 P1 㨇 S P I0 P =HxF0`0\'`??\F\ 0S P `S P I0`  Q& ?0S IF&?F&?㢣&?( QF\&h>, HF`CX) s}00X'$$^BY şLC$$ 0S00%>$dF!ꀥ5C[00X T`P\+ )<Q) ' X> R? $0` Zo P /^Z >0S P 㘤`S P I0` QB[ 0Q_ ` 4$0dt>QR0` `VB Q 0/S-  #0\>Q ^`P: 0 D J\Q`P( D< X?P D*x䂟 QW k 0S0Jꌂ0Gᦢ $Y >:0P PU|(P0 R q p@EE ` 0Fp`C4p衟A N$`` !Pa!0S[  *40> 00=0SH  RDȄU BH U [ 9H 5H U0  *4劅$0>  $E `0\0$ (P}PUP#zK lFb̖ 0,<HP\hta̿(`tbhO-,M@%(dv`\+(pa0@ S;555555555555555555555505 (`pa0@0%SS@S  i`` ```P@``T,Ѝ@D T 0U0S@$P şX8 %^4 0S0 <P- 4 Tu ğXx $`T $B bG$Q P{@Td 0奶Ph %6T>U@0{#OR T  H` CS `p厬 +ሬ뎬ß0S XbP dc0`P LCp`V 03c_@\"^ PSqPOT  Pc !Ra@P[ Q0 00PaV  ?V`fqp`,8 pR= P A^1\,X Q0 R*  S1 q^0``p<`Q P傮P   0TL1,1Y !0#00ꬹP!Pc ѫ0PЫx3 0!{}80X pg`f r0!iV̖܋0DPG-@PMx 82p0RX` -Q" Z<vi T pc 0-^^ UP ?QP> f@Tz3Ѝ\ 0lS+ sSnS -SA ?SA WPᥐ@p`TZ T@T3 `P0P`V@ ዐ@`@p  LPP Ɓ P h@ ^ V H`P0@-@P M+ 0SP -Q PE R @T 0E R Ѝ0 R-\@T P 4,O-@  @TXAЀʿZ 0P 0 +R0 -R8 PaJu@ U P 0e`00P` \0Pa P 0   @u [ZPh0@bPꄶP@-@ V@P1O-PMy 0S 0 -Rh ԃ P@p``-V +VR p3U `Pq @qW P t@; 0RnS@ -S S P3 -V P`R@PUp ؀ P\@ t  P0P` @ @ЍP@@T0-SPUpBP& wP EQi@lt@|p-|pQ0SZ qTD@d 4@D1@ 0JpJq@T`0 J0Q  P AQ B0C AQ   L0@0 0QP@@ ty t@u@a@pP 00{30ꄶ0 R/P/`0@-㰑@i=ꐶ@-e(0h  !0l0萶8@-L@PU 5/P 0@P $ 00 0P8萶(p@-@P٢ P p@[p@0'O-@ 0kM$0P O opbH 0 D @ L $ ( , pS a@P YYYYYYYYYYYYYlYY`YYTYLYVVP  @RSR  0 0P` p$P@pt{ 4 g/ <Pc 1S`!R]@0D pmZP(`tPL0Pp @^DP( KKP-Pd0S`0T0 d `T SS!0S`Tp0Z0 4 D< R L^ ̊P 7  Ph 4UY hPU V(` @\D Rd  x P^: SZ @Q @P( !PPXPPHQ{ PH @P 傜d r\`P X^ W ^ &*Lp,0 P  ARSR$ P  (p0$00H0ZkߍD@$Y(@T1 $\xZ$ 8:$@ T' T^/ ldp<: 4i?\ o%P2@]P P ^? \@p" 4i\ R  x%P 0\@W_  ^?Pp@p 04 Ri 9k%P@pPWύTPP lW0S R   0S 0S@$QYP(^\<^ ` Y `& 8Ɵ[74iP  %Pi0WdFp fP vP QD Ѝ@P,2`~V 0 l*D D0Q `V_ Tp' \ qPC Ze"0P0$ S 0  LhD1Z@! {`"ᰜP@ [t @Z '&p  U !`͜p [``&p TXx%8 6nHO-A$M`Vk P@p 0S[ 3/0P0S  uPZ@ 0 S >0P 0SPZ@ P:@`V P\  tu ``VZJ ! P0P0P#0tP*l QPPU000 00$ЍOl0P0}@x4A-需`0S pP@0SsP 0@SAP0S 3/c>PxG-ؠ0pS ` P@0@S RsPA@T  X 8/!H >p0-Yxp@-MP00%`Zl@P-ЍpP@- @L!@P 0  Dt t@P 8l4@-+40S  10 S!xR0(S$  -Q -+ -@DPE-@ MPZ`% @p 0S 3/u Q @Z P =Pu Q  @Z Ѝ0xE-`PMa *`2p ?P?H"H?PЍ @Pp-WV Wr -W+Wo@T ?T< oT@T. Q$ 0S! -S +S PX`@T`V@=p  p @?00D+Wr+Wl 1@P a+ok0S @T -T\`@V@T X   1@P +Kk@{+x`h=v+e=THA-`R@p X0V00< @0PP' 0$ P1 srp D(00 RjXP 0^600@0p` (0* TA-pQMP` 0S[0@a @ @ AB@ fB@ iB@ rB@ tB@ xB@  cB@  l@B 1V00S00L, WN `Vi `Tv +0% 28 uB@0@a @ @ AB@ f@BWNTX*T+0@@V WppW 0S @T3Q3Ѝ 5I3T`fP` R @PG,@ x+j *3` R 㱗$+HD4H@-@P 0  88 0S (S PE-P! R0Z @ P tpt`t @P Q Q P @ iS0@ꘁO-,M@P`p$pA0@9 /S񟗝$~@}@ppA0@,3@T 3  WP  P$ 0Pi W  @TT 0VP-P H`+Q` P7 X& =  +   L 0S9 $Q$$1P i0\0 0A  `\ZPXt,ЍX   YA^UP @   07 v/Z 3 Z R P `p԰@X0  U @  0S S 0PP00hQ/@ @ZP@LThlT  G-M @PS M R ? P 10SC T0 @=5@`p) R \hP @U  0 $P pp 00p$+Ѐ 0R 0Ѝ p$p@-P\B<X2@Ty L0PP48Ÿ R; /oP5 p0oPUw H<P 5A0S.UAzP,0S@xpP/nP @pP6<1^=P2 P\p{oPxAzPaV RDpco`A{ tL@Ph j @P 0HPbz|@@-0SW Q @?꠭P0@- M @یPbg Ѝ0800 [R PQ 7P@-MpP!H`@O L H3 B3  <3 63 P>Ѝ̖1A-PPP@ )@|`pSV( uV P  T(TAfSV  pP  t pPTP Tj(TD oPT \(H(G-@P`"*p lP pPW 5|Rh`p\2VPy0u03T@@TDpW @TpQx0Su -S\p n}pk @Te 0S` -S`e P㬁V= {@T T}p3 VpzZ6 Z1 Z0 S@@8@SUCPU  2}p`@2`/DV`GdzP R GQP }p @`@Tb``v`3H8ܞpO- M@P`p0SpPV p` X P Vo pPV8 X6 V@ȓ @$W@T3 \2 P4Q /[  @Z=PB R[eV9 Vp  @sP 0~k .epЍlPM- p/W ^ 0S  JZ@ d.eVp D J &Ps ;RdV piieV @v.o _a i.ppP? AHVp7p X&ID  &,H.$E.*B.8?.'p &"e2.( & '. &... t }&0 .pR$  r&pJHKD,P\G-`PP0-S@tpap0PtSy -S pS aS0lSlP @T 0P-^ @4pP0@/ $SW|tl`@xpP0@d!PU `pPX`U UPWX`&PUVG|@ @@@@0 @kP pkP |kP lkPx psHukPnpiQ e|ddltn0@-AMP@pP 1 0 ЍЀ 0  P0`0`G-Pa@p@Mw! ` R 0 R  1 {%@Q  xZ% 0YX  ?  @Ѝ<0pW|{! ]%,HO-WD D  Z"QD 0D P!0   ([آ$8 g   (DPD \D [^  $A4"Pgx""(` p0X"LM L0$"`0`n$`D!P0S @ Sl (Q , \C 0 0; `C PV   } \j @0` k[ $08 6P V먯 Z (LAZ$( r8 (& T  0 0zT000HTT Fȳ(CZ0C ^&C \P   N P 4S( hTT0000 0#Tm0 0b @ k0`G (E[| 00ubT000U\T3VT%0 00 R   /ḸO-4B0S pRSP3 YU PUR    %[a[P  0SR:U00S0|1 P p l@ 0v? X0  :R R Q0 S!    0!-QP-U\00 00SP\P PP:U?P< @ 0)U 길bЖ0   /иp@-`+V``VP hC P \3P!P 0-S V +S\ -S S 003PP:U oZP 0:S0 ;S. #SV  00^phPP  04RS<"00P   ?Pp  \ R :SA -\ V; +\9^6 ;SN P1h p` 08a0Q.0S 0\P3 P P P-\r Ro P  RdPO  P0A ^yl0\0 0D $0P~иbO-d$MP@ 0 80@ 0pԳԓp@ A@5P@0xl`THXEpp@'EpHp R p R ppp R ppQ X rYP 0pIpIpKpLpLp @p@p@p@p00p  ppp pppp R? p00p 0Q 耟@ p@ pQ ZYP $Ѝ d ``q/LPl*8 ](0c!`ܸ,X\P@-M C 0"  2P` P 0S Q`  R  IaPU  AY 0PP0 Y,".Y P Y2#Y P Y! YP Y1 YP Y|Y  P Y۹P1X P Y,AϹX$0 @P P  *T  R0T` `V Q `~ Ѝ` `p`jl<`3@8p 0pJp&@+ܸTp@-@`KP @P      @    P tP lPP PP @wPP (P lPP P aP$P P VP P P KP R tVpttu `dr LTo 8Dl $4@i $Pf c `  ]  Z  W  T  Q | N twK `rH LtmE 8dhB XXc? DH^@< 08Y9 (T 6 O 3 J 0 E- @* ;' 6$ 1! x,(4<HHLPTX\`dhp|4,p@-@PP P @T 0P, 8PM@Tp@z8@-@PP P@T 0tP(  P1@T8E-`PME S@0 @@@@@@@@@ @@@y2P` pW$Q W ` Ѝ`V`0x03 &\ W `Xu ` jp {W00S Ve0P0 sWⒷ!V P hW⇷xV0 0P ]W|L! VP RWq VP GWf0V  P 08豷0 8p@-@PP` 0S =TP  0 pV  P0 0p(Pp@-0PS I`=PU@#U @ P  :pe@p@-0@S`P @P 5MP UܵTP P  UpPpPU`PU V \ VP0=S(@-@Pb@-(@PP@00b :- M00  Ѝ- M00  Ѝ@- M 0@@OUnT Ѝ@- M 0@}@?U^{T Ѝ 0  /@-D@M  c0 r0PЍ5p@-h@P0 R S H` 00P0pU0  0 0pA-`P@Px0pS P xP @-`P@ pPd0S p@-h@P0 R S H` 00P0pU0  0 0p(0 R P/P@//ᄹ 0) ̀8@   / 0h /00, 0 0/ 0 /@-@P 0h0ã 0 /p@-P@Pp@p0@-T@DM0S @ P DЍ0脹  0@-T@DM0S @ P DЍ0脹 0  0@-T@DM0S @ P DЍ0脹 h 0@-T@DM0S @ P DЍ0脹p@-P@DPp@pp0@-T@DM0S @ P DЍ0脹@-,@0SM@J脹@-(@P@00脹O-p4M0@SlX uP 4Ѝ (`LK(P 0`|PxS =K P)   U @ [!  l@T ?Pt(0@T 0JJᥟ`p@-0 MS@P /S  b0 Ѝp0dS\` SP  Q  J `0ꪴ 0 0@-0lM/S@P k0lЍ0dQ< $ SP0 iS+ oS6 eSrQrP\ P0 0S& I#SS SPQ0b 0nP\ < LSPu^0tS0pQ-M0 0zPЍ80kSXS S@-,MpR⺲ P`Q/Q@PY  p$0tWpp pp0P1$@TP tPP PQ \@TI,Ѝ@T$夋P$堋@pA$喋Pps o P г0P0e ( tPXHT|0@-@ 0c bS  B=Ƀ R @/0@-@ ,0S 0=9C =C 0 @/?BO-` 0\0#=L0 LSMBQ qAS净pᕷCȿ 蔬 ǿIjTJk Ϡl10 offSjpkQᕬa唨`ᕦ 唧ƯIj̿Jk ȟʆi10 vgS`i kQr qpᕧ唦 唬ȯIj offǿ1Ik0 `ϠlSjpkeQMa`ᕶ ɯEYj ϠJlȏ ˶h10FgS `lGQ/d+Q AL |P@ᙴip4a ůHyg˶`Ij0 ϠlSPj@g#Q ʒůVj10OdS 0Sʀ0Sʀ0S1Ѓ0Q ЍPᐱAg@`/Ab0pϠaAl /qAb?BC@Bgfff0`0-POTP@ dP`H0COC3dO0d}P00S?C00/C@BMb@-M@   00Ϡ "lb1C Ѝ艈A-PP@` 0S  .SC  ~SP p93ذ.pP `.V9 ʰ0S`   00SW*0/S/000P0W W GpP P R /R Rp/^@@pPpP bP⁰OpP{0p.0h0@-lMPܱ@ @rP  PlЍ0O- M P@ 0/SPd . 0`SP / /S* .S+ V 0/SS  00/SS Zp0SPV/PV ЍpPo p  p p/RR .Rp/QQ PV RYP0 "`FR*/\ 0v/S /S8 0 0/0SV00.```  `FR*P/U  0/S 0"/S \ S0 NOⲯN@X0/S0/S0 0 R @P*P PF@t\F@mO-MM@fOP儯 Up]O|N`/[ Vp%!@!*@ s  Pևml@<[ /[t .[w PZ P /00[[&  gRX0b/SS  RMQ 00/SS  RB00/SS R;00 /SS *PvY N \ 'N* /0 0NN@/T^  00 P Y$009F7FЍڍ0 @0 /SS .S0 /SS{Z  J Q*@/T J P*@/T z/[岮`M/[50/S2/Q /,Q 0/Q: 0 V?*    \և0\ k @0 E/\ /R 0 /S^~ S{ {Mx@/Z/[  pT껯(00`p@-`PP2 0S) /SN;XM`@EU T@ t N0?xE@pPs@P  +`jEꄯ0@0p~0p@- `PU @0s pPP >P M P@0s㶃pl@@*P P@#P<P,P PPPc<=O-$M8 ,A,,a,P pM1 Y ! # ," 0 L[ 0Õ[ -!P0S  Nc 0R 00PP $ЍDcP8@-@PP@(0( @P 8/O-MS@`P A p)M0Z峮 # !" 0"0LS0 00̕ XP  bY0 000PЍcPp@-@P`p0SpP6/PPpPpP/P E-pP MP`  0 P@ 0VP00 ЍS@p@P/0S/P/[@-PP`0S0p@V!@PdO-@P MZ `VW PUT QW 0ST P[0SK \H 0SG0> U< P^ \ cL Xp0KY PC0Qp`aP pW dXp ~K0zKY tK Ѝ Q %L Q L@-@P P 0SP00C0@-@PP @sC@-@PP008@-@ TP@@008.T0 DS  R 0S 0S 008O-pPQ MPY0 `IP`@ KҫJ  Y@;V `P K ࿫ J  Y@ 'KⱫJ Y @0Q  K⠫ J 0`0S@ Y@ [I@K P ap _K~J @[`3Y p pP KKj0 J @[`0p^ :KY uJ @1`Sp +KJfJ@[ `  Ѝ A-PP$ 0S  R@01pSa J 5J @RQ  !p@-PP@# 0Qp T0 bT  R 0T0T@pp@O-`PM@_ Q XЍX`0I 0HP q J⹪PI0PXp3[  P J४ I0PXp\ uJ┪0I0P!pR fJⅪIPX0p  Q ЍO;0S 00!R/@-@PPAP@-@P@APG-@p00S PPQW TaCfA00 pW`FX( TJ4SvA pW`2C Tp 7 p` WT*MA"pAA W`Z 0 \ Gb֩E-@P`d0̩T0 DS  R 0S p0SVpA`Vp U Ip⤩H`VZp0A-SP QቩpP@ @`@]I|H0`P  Q 00!R 0! 00RG/A-`P% @T" pPPAT 0SGPP  !0P0UP@O-M$M:* 0/Sh 0S /S  Q0„0S/S0TP  ovPr   vP/ : @pRjP` Rj`;R9  @R R T02oGP T hGP0Q0G\ Wv:H 0.S1  R1S0 0S\00/S000Q 06G0PP PQ0&G0P0^$Ѝڍ R P0.S GP.Q<=8@-PLH @@P 7P?@8P R 0 BuR|p'p'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'p'p'p'h'p'L'p'p'p'p'p'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'p'p'L'p'p'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'p'p'p'p'L'p'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'p'p'p'0'S  S=R :R 0 Ry/S/@-@GħT< R9 0Pp\`@0`#   R  R @`RRp  R @`RRp  RR0p  R0X8@-@^G|T R 0\P BtQv*********************************************************************************************************************SP 0 R~008 P 8@-@FT9 0S6 @  \S( 00S Q0\S 0T 0S Q\S 00S008PQ@PQ@ Q@  X8@-@RP" 0 R \T "R R"8@-@eF⃦" T0  R Pp\`  R,`+   R" R A R$`RRp  R A R$`RRp "RRp  RX8@-@F3' T0  R \P'R P   R'8 R 'R @P   0R 'R P 0 '88@-PP @T 0@T @  88E-@Pp0S E ڥ$`p'P`U` \EU\ t@18101(1 11 1H1H1H1H1H1H1H1H1H1H1H1H1H10H1H1H1H1H1H1H1H1H1H1H10H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H1H10EPPPUX'0g0rPfPvPnPtPbPaPo 0 0 %0P00P`G-@PM(p`ЍP  00 Q0`P \Q@ T QW PfPP "@@VQa333333333333335050505050505053333333333333$533333333333333333333333333366 63$56333333363335353534\ XX\  {X  0差0 0  aHQWHAH^0H7H aHQWHAHQ0H7Hv Q aH^AHWHY0H7H }X @\0@0A\0P  0L0A\ \ L0A^L0@刁0NP0H| w t q n kS&nXk  000@ 0  W  0OLIY\xP WE-pa M`PX @0 GS  R 0 S  0 S f 00 RU`  Ѝ Px` ;O-P@AM M `P: S CߍٍCP⠠zh 8p O8ɍh ᰐ| P H0 ^, m PɍH  Q ^ wPH0 ^ Ÿ@ B (QP h N0 !x240` ` $P 2D 8.8CPp@P~ 8 0,0@Pp0P4 @.T C PU 0,=B8 %P 0 @PɍpAN@PRA $Q$[l$ ` Q p 1^P P @Y 4 崐ɍ؁( [YЁ9$Y h 00`SNh ON'90 CSRl H QgP0(^chh :N0` 0$,4pO-PQ p@`( P0 0E>St!pG⤿ @d- Sp=<<<<< =<4><<<<<|>0=Q0>Q@0_00H ϖ@P  E0 Q0W#Q00H ᾖ@P00A0H U00UUSY00S000H[-00H`00@0H 00@0H꩐ U Y @!? UBacPE00P#C0`PHCH`C F GB玣00 T0@@ƗHT 4?B1cD0`@S`H 0Q00$B0H 0Xx0 C HC0 H1@D0@gfff8H\O-pR4M@PX` p0 0G>S`\  / @tP- `F`` S~?AAAAA<@AAAAAAA4A Pd@0F\ W00WWS00S000F R-00F 4Ѝ褱ᅮ⥱0 F @ P\ 0 W00S ϠA WAAl1pG0p0#C0@pF`C`F@C <呬  F0B֢00U TE00@@`F\ $Q.%2@F@P\ ʿ  ᦗ0PY X0 WY#X0@Y=X0Y>X@0_00F  ጗@P \ lT  0g 00  F `@PQ\@0Xx0CF`CV 0Z0`F0 Pgfff8H\0/S@-P M@)?@ ЍHP@ p`P  0AN @r  \ `V@@p@-M`P @   0P  <PЍpO-M@@ᙠ` p (T@rp  L`  PP0d0P0S dWpYp Ѝ7Y0P0700@- MpP@ P l PP Q Ѝ0c\U00T00TTЖ@-QRO-@ MP`9 X3 pZ   P0 S S P" 00p ^  G ЍPXWꃰ S: AppG0S 0S Pp- 0-S-S+S` S .S 0@C P #0S| .S 0@C TQRxv0S0PC@i .Sx U00DS0@C` .So TA0@A0 SR .Sa 0S` 00C@ T0_@TW 0@DP UWP1U0M 0PE@ TM@1T0C 0@DP UCP1U09 0PE@ T9@1T0/ 0@DP U014\@9\@QR@\``  0sQR00 p/0` S(@ AQR0np-M  0Ѝ0-$M 00aP P$ЍO-dM@ PT>JpP> W@8 @P`nP >0@T`0\0 Pk ^" ]P@ d0[LQP    兄 60S @Z X X @X X X2 /\P JZ QMM(M(M(M(M(M(M(M(M(M(M(M(M(M M(M(M(M(M(M(M(M(M(M(M(M(M(M(M(M M d00X40L@pX0\0PP@ H d 0K RP@@ WndЍ 9P ҟP  d0KQkP@@WOa0  0P> S0  P RYJ [  gTb0\ d0JKZ 񟗵DPP,M,M,M,M,M,M,M,M,M,M,M,M,MO,M,M,M,M,M,M,M,M,M,M,M,M,M,M,MOZ [ 0P%T( @WsT  R+TPg 8c[\ P ;  QU  K P`0DCl>I\  B P 0 갧\  2 hP t0 [ @W P P0@-EM&0  0S 0 RN P@"Q@PQ@B  PEߍ00q03O-P PPPCM*K,MU@0 @ KB}KpGKqP K/ᏠKP@hKBK0L`bKCK K`IPKCmK pFGC-KhK00B`C=K CSRBK0AQP^9 zK0&` PBK v0 AP0@ KK@ T*KP  KJKN KP:K(KCKZK ,(  =j`P` K`ZK `*K00Khj0P`} .Xo BMK0PDCMKԀ@YXCK ԀI SR<K 0@M Qᅁ H/  H KPJBK0N(KSRC]K"K@ESRK@iTKK` ` 8PPn   d@eGT p7*K1几 S  3PPKK PPnU* @P 3P@Y .Q~ꪝ *K夝:Kp`@V`i PXP`JK`:Kn GZK/CmKH pFi 0`GCKWV ABMK BmKC]K0D0pE0`F@ `UTQHt pPP:K*K`Q  K`q8@Pd :K P@aG`L:K@`+3``JK`x3@PV K JGa PVPqZK PQPlBKHQKIP P B KP@jV`K/`*K`KP`U zK2*K0t03 hK KD3@P'  zKGq Wa 2^K Q :S K@ K PXP+ZK1"@ PSP@*ZK P^P%jKa PVP <=TE-`P@p zP@`TP pWd 辜0S ((0 000 0/غltp0  /غ0P-1 ȠȀ@İ P0P$`@`p`@,ppP8@ @4 $ p`P@(H <DD LDH /ptlcغ,P-3 Рp0@ P崠`嬀0pp ``@P@@,``4@(@8@ $@@<` `$D0D<<0L H /ptlغc,@- 㬚$ (*   غO-@崐崠 娀-p -`-P--- x- p-h-`-X-P|-cTHpt$x8|p@-A,0Sa 1PPPP!PPR`V48PQP_pPUl PPP\<` L!LVPQ? 0P7 avU P-gh_04Q PU 0PLak#db`0S0,PP , ?StW 0<0غctplȖ̖XЋDc\{dԋx@-@@P0 @-Q@  P&QP00غ1@-(@(0S0(0(0Sغ0@SG-@P`PBs O1無SQ '*0S hcS TcXßX P 3/$ P Q PS0SR03X GS[ bPbU" TQPD PR9xb  'O 00GO1無S0S T\(Up  05 |V( 0 @P 0(6 0!Sz P  P 8#8M@(P R  ,P;V  ^ E 0G@`V` G3PV N{  0a IjOP0 GN]HZcغX\\{dd0 dp@- M P ȑ\)S Ѝ1@8P S$ S  Ѝ@Qq`0 `qwNoN`0  @T@  Ѝ@|   E0AdXx8@-0@ 0 0 RPU u00(0 (0SPu 8hP  000FUo & 8ZHPغ0p@- R0P4 0S P@S"@PU 0< RpPp0Qp \ptPpp@2p1/h0PP0< RpH0/@ Wjc\{htغpD 0@-H0 M@D 0dP<xA$PUF hA00%O  p0J pC <S s $!@01P,0$ R Ѝ0H\H @S Q0% 2/x0\@$PU ]PE80$ R4P 0 غctD0A- `R3A`PP@ 0@S )7He6p~K` 5a/]Y6.LPQ K\V 7&AB6o]Eغp@-AQP0 S 3/T0 S`\ ^ 0X R000H S娣㤳夓0UPVP00 CPPQ^ RVP  ! 0 B00UP 0 @ E0@PCB̢p" h00zp@p TPŸ @W/ [^ WX00S YW0 ^ ^@D@c\ @Wp@ Ѝs,D; 10X> W XE WXX WK0 ^ ^ @DW@=s ^ ^@D@ s R R TIY0 S S @@җ0  !WR00dXyX J0h긗0   WXT cX pl cc@tغL0Sp@-PM @PP#+P `A?AAPЍp|   ${C`U,`,0\VGpltE-pW MPL 1P^aPr@+PZ ġT@ WT@@TAQ |0S PEM|P \8 Ѝ8AX4ŌQA"?U8 x  ! 1lP  0  $ C   0AWT@@hBN]AgA XL`0\ 0  FLplc c8ccdt0 @-0@SSQclBc@`L0S0@-P M 0@T@PP!*P > Ѝ0褖   $BhB80U, Q|FLplt0 @-0S @FItp@-@>I(8@-@ 1T!P!A0iP0$ IP aP'|0S ^- 8| R R  Ih0P8|0S Q AP| R \ Hb@8c ccLcp0Sp@-@P ` Q$U `E<PV` V<PE<PUJp  ,`, Q0 0/eptغO-lElU 0$MR`$Ѝ/P<0S p$@X ` V0 0 Y qW[ )@VN@`HV0 0 E i qW0 @~VNH? X00 / 1 ^ qW, ?\XNF?IH  C0 qWI  8 qI qIFys 00Td P`FZXX 0 ST c 08`P UQv `8P 0 0@? V"Mo?z0 HS(` c 0^8`P_ )QM `8P 0 0@[?0Vp LHB?M0 S c 018P;P< Q7 8P 0N(?0X LF?qHHHjP wP HFOptغ0Q0 R R\5G c@P@- 0S R| t@pf PU| \0 *| PE 0 `a | |Lغ8@-Px0S@l0P iSaS IS AS CS d@0Sڏ>P8>( x 8|>L L@-0S(H44 4@ 09>0Ńpc\{@-@T9000 ,, ( l@ @c8ccLd8@-P 0@S \ \ *T =T& \T F8 R R0*T0. +\\\ \0X0l@8E0?8tpغc8ccLd/Q8@-@P ?Q C8uO8oO8NQ@- nQ8@-\0P@Q 'RD @dPO8P8P8@܋@-0Q@$C:@Y=p@-`@P @@@00@P@P(\ p p@@0@-MP @0 @P(0  |Ѝ0LDp@-PM@`T t  Ad0ddЍp00Q@ Y@ L8E-t@t`P0 Rp@00婈P0   xp@-P`PUpD@PP @PP@0Pp|G-똠0pW@ `pP@ p!Rap PU\@ 0xp@-PPp0`S( S# @S@0S S@T 0S0@0S @Tp8@-@78P000@ 0 \0008@-\ !0!0S  40DL 0 S  x|@-@Tp 0 0 P` 0 PP\Pp@-PxPx@0Q   LQ P^ ( 0p@M 屇pغp@-PQM@@Ѝp P`P P `P 0^S U`@t,  wP@xPE`@P@- L]D40S (@P ~M ;tcXE-`ATMVpP.`FV  p =P>PVPp :PP 0R %PVW LL0L zMQA 0 tplp@-@PPpX0X 0S LS @@Q T/$Bp@p@M0p@-@PPpX0X 0S LS @Q T/$Bp@p@N08@-0P ! 0S @Q%p OPOOx Q@B` ``0N%8@8OLD%@@@8ctpl@-(0P P@@-(0P P@@-@L%(0($ ( $0, pl Q8@-@P* Q. $Q2 Q0S! )H$O-hCM0pS ЍM1HP;8P萠 `c^<4嬰@屰D声H寰L夰P孰T嬒婰X媰b\"嘲嫀4D <@0H LX0 PT0 \ X0   ŸXg Z` u^0l!1   00P 0WppW0  08 0zP ^0  0O0S0: Qs 0 S @RpSD  0Sv2[ 0S| |3/|q /Pm @⋀|@| R/\J/  P0SG hPpA|UOЍ^끊P@P0  _ @`0^? PU`r .S8a.p_p `0a! \ 8P0 ^ P/S |r/P{`0Sx /SPPq pZ\| P P* R |JTt@-0@S' /D! P# P \0BT* R/R  0CT * /R /^ s/^ 0CT:/\ p@-P` @"7@yTYT@00 T nTNT T T? V T T qTQT 9/pppA-@PPp` P 0S xQ R Q P $Q  P U 0S  3/tA-@SP p`PT 0 U SU QQ X00S d0  B{DWA4 QR^ PE^غpRp@-`pM 20SIŸ0 Q,QAQ p@ B p@0RC R pЍplA@0 p0RC YVP `aP&  `P: S, S 1Q *(@T@@00SSl 0 l@  ` ƩP* Rh0 \ P 0S T R ^/Q 4@$0 /RpttغTO-`U`Q M@0`u0P L0`4P 8P <P Xw~80S Nm~/4`4@P 84<DZ~4w40<`~V @0S \3/ 0LDS 43/P8@T 0DS ğ<3/<<4K8pCW`0 ^ 0S 0S #3/p8p0`8pDV@htts> K@P DYP`0V(.S. `40S .^ HpCW< ~\ @p}<p < 0S/\/ Ѝ.S\ .^0`VT4P D48P (28<Pp "p RHʀ09Pp@   @P0   0`1P8Y 0!  . 70SQ0 0G 0QQPUpeP \U"U00SPpP R ЍU0p?PS@Pp8   0Qp@-PP0S!1tpP!QPpP4 PG P PD p@P' `PC(P!P @ Qp1 0Q6 P10S p!Sp p0P `P P s}t@p p^> P0t hpppT`p4c`4`D8P`tcDcc(hܽ8E-ԠPH0S p`ĀT@ 0S00/ 0S U 00S00! 0SATT`  P: P6 00P2  P.P*P&P"P@00C\ @00@S0 A!0 B @ @DP ACP00C70CABP0 B7 B@2@0S 0\^ @<P \PCQ0-S@?X0 &x00 00 x!0cc@-@P MH (am @P ?"Q'Q00000S3 Q1 0Q0 0 Rp 0 Q Qp 00  R R0pPP m u0Pm Ѝp8O-QMP `\ 0SY | m pVPT\=P1P! ꁡ灑Z ぱ G [` Z-[ `\ @瀐AYZ P` X灑P P`P \` mЍZ m U m mcX@-p M@` -m P@P 0w Ѝl0 j0 dp@-PP`@p P (0P Pp p@X̞0 c- M0 0 Ѝc- M00 Ѝ0 0,cE-PP M 0 S S  P 0 S S0 S S S #S $S ǟ R"S@1 0S S:S  S S:S S 0@S Sp W@@r0P S` S S   S S 0@S`WJ@"Ti - 뀦PppQC @ㅏ@Q< APqB44vQ [P R @vQ MP @P'U"Upp 0@0 P BP0ş  Ѝ  R R00`@ 0 @ R R0 `R R Ru    Q Q n 0Q`ЄQY P{PQR PQ1/ S@ 0S S S S S` S S 0SP( @0* R Rf 0CS: ^ ^ \ \s P P0CS* QR3Po{pOw:S`=Pp `R R R0P S SP0`S0S@ R \S  "S_ @0SEu0  hupA@'S"S0 R @P\R R:  R@@0S S S 00 R R0 R00 RY R R U S SR0SN`@lPP  _@0!0!@P^ k0S@  \S "S 0 0pS Q 0q3pP'U"U 0P CPL0 j` cLkO-B|MH`@RE pPghPj RXU[ XF ZD<p70 S0`  `b` `0 \  P `0 ^  Z0` 00S 0`FS S S #SS D`p0ZD06j < |ЍLV P 8 Wjt LUk ֕P$SR*0 :j P , [\P  v k0P(0niPfܽE-L0pPU ^0@H`@DPP@H`@DܽP@- Q@1P0@+$0LPWP (4ܽ @-,00S S0    ccdDcr8@-P@ 8@-`PP 0S !iU(p P@! +V P p!htmi\ 0/w p!iU( P@   P hO-PQ@p81\0X(S PS HSD UD UD U0D0 DdP D@Tb jP'0S@ DPFPNʀLPM p`VjPz|ǟ RvH P 0$ P0 H`0R` 0 \ pH R0 0 `H   p0HR 00 qDPHQ I\ P񟗺$ %P$$##@^9~P 2DP pW%V0S  @h`p p ` p`P\``0g0?S W X \ @`P`PX00@`PaU``ƣ@P p``P\ 0S  0C 0PP` p`P\,O)4($ $Tp 0`V0f0\ pğ`^ 0 0PP` p`P\Tt `PUc6AP iPY 娃 Z#AP iPP  0A 0A Pl``5P<`@X `Z?<`V00SX4\P 0\P X \PPg`P`+PP !0 < <4(<,  2`\  0\UP`P!` p`P\Dc 0P 0 ``P PE`P\0 0< 0ge 0e pP0{g 0 U        p ^p `e0` p`P\Jg0 S0c$. .|,pltغ@-@P P P @g@-`Q@P, 0pPX:P 0,0Pc=.`0S0x0 V`-`0S0,Q `((`0$ ` ,غplp@-hP@ @a`D`@00fhP4\ pDH `Dp@-@DUP@@-@hpfp` Pd`0(0$ ```` ``/d`4`8`<`@`D`X```\`0,plG- R@@Xq!0@00 0S0d0/&-Z\ PY 00\0f\`0  000```  V 0a0S2 00,`<`}Zf`X ``@X. 0`0 @\ BDPG0<.fJ ,Xغpr`pD 0< \Q000 000/ᨋ<@-P@00S R P0 `>`P!>U@!`ʢePV `W Z `W ``W|0 >WuڄGW`lX `Wd`WY<Ћt@-@ P- 0S*P` `V"@ 0P  0P1 cP p@l LPpWo0P 4A\0\0<ЋA-@ P J(P F0$p4`,P P1  >Pn` @P pXP0H@ pc0(0P  8` Ѝ@@P` (@P Ѝ@`<t@-4@4p 0R0 p 0U+U`! pp SQ pP S PpPP pPSPU 1pU  P7`` 2` 0 pP PF`` B` 0 pp7`p 1`` ,`` '` 0P0P訋<A-\a\ATq P UP*0&P ^PPraPQ% PXTUFUQ 000 0! U01P -( 00  9<ЋTcO-dMp @ሰ'aPh`0Sd` o 0R$`m aP$PU[ `` 1P`jh T,`0:SG P 0P 0TP R 0R P 0TP @g(@[}Qz 0 @0 @P0 0R Q 0[@ T00V00S dЍ- 0SJ d SQ h͟ 0 b$RP͟Q Dm^ 0 @R`P34\/- 0`Q 0PڛHD`D0 \ `PVk cP  `VU PQ R @l0X $`RP `  bT 0S Y` 0S`  S 0S S0`S P SR` g  (, PC g(?#`PP0S ED Z V1* T0UR  |0Q SKL  Z V1:  R0P8@ 0S  ` << Pq +_P *Qh `Vjpʟ`P0``8Pr*0Sf H( P`6 YV3 _ Pi0SX0 0@0`S):ɟ R h  _PLiQ~  `` _P9\ RVX`R`h`  , } 0Q8 8(`00f, l40n_P|(P ` 0S8\< P Z_P{,8^w,< i`K_(0cPǟ^o 0V  Q R  \@T VpP HG "\ R Q $PM  RI8@H<TQB0_0P &\ 00F^P;& 6`0S3 @ Q/0ch0)@Ɵ$0 b5h&`8 g 0 h```k g00^0PE  %`Q @\H V <@Qʱ^P E0S Q ` PP_  =X%s9 4 @aT ^PTQ5 T @@~^P 0`0S @ Rch 0h hD00_^P@^d0 Q`0S P S $ @a ^0c h 0 0  6PP>0SF80,pßPM f[J83^  RL#0s* V( $[$ 30S R^ [ @K "88"8["K4 R* ]PXŸQs  400Y 0 b]P0S  \ `0S @Z 0ch0Phd]P!`V P $0^8 0 S^5 TPPTPXPLP T J0S` P`@s5 0Pm5`h [@0S L 0T50 P @^` @00 $ ``P$ n0 bЋ 4<t h040g 0P4 Z V1*04@ @8P` @ T4 4`@Y V1* PhL T`g0LPTX@n5 P 4@08P^QP  00]\P!Q( \Pa0S  <`0l0`  gP` g 408 h0 4 0g(0P    0S2  `Q @ ^ah`, 0P8@T 0Q vP`x Pg(P N @, rPP(p`B` 4 R#P K`PP00Q= ;; #'7a4@  f4@@@(p`,P \nDDP RP 1l4P @T $6$6PU $0``h0f``w\ PVPFZ PU Z P ߽۽Z 0H0D0[D0 \P 0SPP@  ``%6 g(P(O-0LMSLЍXo%Q P $ΟHPX@ jUP l P@0P匾\P\PP弎 U R (PU X8 R P  Q\^tP 8@ @008Hn` ^X! 0 0n N 0$Z @(rR[PH0SD\Aڔ 8X@  >0 @  " @P): @^6 Q  0P+ @Q &% @ P   @R  Pژ 2 @ (0S Yh<`0 ZP< RX$̟   `0Z @d$ZPԛ\'  $  X(0HZPx 0S $ ^$0S7 D P, 0Z*:K X0@lQZ0 0Z lA T@k ZPP   X0 0l XX0@lA^v0^)0S \ \^ĉ 0 ST/  Xh  0 0` b @ X dX 0Sd ` 0a1X 0S[SY0 PQ O ~ 0X t `(0 S@Y ( Xdȟ``P  ,ȟ$0 hD<0$b [ [ħ Rt0S Q  A T@=[^[^^ Z0AT@1A T ([<ʀ:Jb@0  *b   ^ A T~@ ATl 0( plƟ0 0WL& W,6 ? 0fY 0P R},Px^v4(   AT) R  ZA^@ʁ 0W 5  0AT  0W ğ 0  /> c k 0i Z< Ys 0 [  P 0 [ 0 [ 0S 0ZKA T@AT ( 8aAT @ Yl* 0 [  P 0 [ 0 [ 0 `H圲0@l Ti H  d\ȿKoHQRfT<00 Z>00H\8"Q 0S T-  T 0W` @$` h0XZ" T`   d b0Z!ld@41 0Q \0,! P0`h,@0<0$kP  V 00{Vw  0qVp0  0OgVH =,DpH VUUUtغt<( $0X0@l X'*P00  S  *R   0 S *  00 S:,\LZ0 A[@AT ( , PS Z^, P 0'@AT0 (0 0SAZ4 @A T" 0( , \S0SAZʁ00Ut U"  U2 ꁠU(4K0AS@!AT} (ꋿk@TrYP T@Ϡ,+ +;b` hU cU8 s  YUT   0OU4  0F 0DUD 02  :Ul4P0 @\^ VP @TU 00S`0SH@@S,0TSکVP0SX0 @0PS5 \ 8P H%j1 R VdUPtQ PPP`00@|3SPl Q@e 0SeoVP\  T* 0$ 8 0b @$XQVPX&0ShP p0 S `S@ ZP0l0X T 0 0T 0e0X RVP \,'h^0 S h@P a bSd0`0`0t  cT' ZT7 QT( VP; 88^7 0* P@/9``  Rt8QUP(Q nP '( 0 D<0@<$$@"00  TD)  vSld kP  RB P  RXę  P@ @`@P@ Q* 0 H@R`0>@]UP( Rl L. ;#ˠ a+` S0  0S  e ;[Y \ ZP *0 PQ a2P0 0lQ@e@  0yH 0YTlP@e UPxQ XXh 0  b` 0c1o, 0`l@@Z  H0@- MR P P P0 Ѝ 0S ʀ @@^0T0 @S 0 0^@@?@M]   .]0Ap@-$@0S qp8@-@@PU8qqq tq008p@-ZP00{v@p@-@M0S PP  R @Ĕ\ ЍpPq O=q04`qF 3qi /q# +q 'q #q qF q긋p@-00S 3/ @pA-PFM20@pP0匀dqbq  p40 `U  FߍP @-M@`pPFq P Ѝ pp@-AM0S Q|PC aV P AQ ЍpO.| $lqh pXX!HL!8@!(4!P< P @Õ2 !! 0 1p p p p p p p p p R| aVD ap0 \p긋pp ,D 0@-0S  3/@pl<8@-8@P $04S3/) 8pp@-@P0M9P0 R a p %p p&Jp  p0 `Ѝp 7p8@- @P6S V8p0 &p0@ P/0@/@-@J000@-PPMP ?%8 @ f  9PЍ0-@-P@M0P0  p B啮Ѝ@Ѝ/@-@.MQ@iP/@-@T[[@0!@-@TO[@0!@-@TC[@0@-@T@ 5[ 0  [A@-@T@ #[ 0  ZA 00R/G-p`V/f  @P$ 0IVP"X @  P IVP@ 0eP V @    PP@-@-P@M0 <˯ 庅 ㌳߭Ѝ@Ѝ/Ж,-@-T@M0 @屯 堅 rŭЍ@Ѝ/Ж,882A-`,V@Fy 0~S( S S$ T"`PV  U U@D T`FR PV@D U U T`F `R@D V V T`BV F \ \@D@ 0` 0 S SP P 0 S SP  0 S SP S SP~Q 0P S S P P~QdpP `*pO ?O ~R(* P2OptغP0p@-@@PdO  `00pغp@-<@P0P ,`<0O0Sp@莴غ@- @- 6H@R @0Q*  H\@@Om,@-@P 0PP88@-PU@ P P8@P8YP08 P88/E-P`@AU EiU p Z paUpp\[UXP+U" PP 0S h 7 `P c㲻,Y> 9 pc,0@-@ 0 MSP@ 0   P$p3 Ѝ0PT0 U b R,࠳  @ ~@-8@ 0S ,   "p0 0A-S S*@ 0S& p`PV JP 0\(PP LR   B P̊pغO-ap0SA YW  Z5 P PrN Q  Rp0 C Q Q   `TQ0oNX&  5N ,N $P  0$  ( 0$ b ;N P c@-l@lP0`Q 9Vp 0Q|( lp A-pPp@Qp`  00 p`   p`lp0Pc0PcPp@-P@ `U10 p @-@@P ,0 0R 0pcl8@-APZ ^࠳l1^P:Q0\   S S /SA0\ L S SA /SQB0R^* P  8 R S S 0B  00QAB\ L0QA S S/S00S 0\L S S/S00 S]8pغclp@-XAPO ^࠳@1^P&:Q! 0\`L S S'0A  00\ S S 0R B S SA0R B S SAQ^*6P  p S 0A  A\L 0R B S S R B \ \ppغcl@-( (@@0@iptl0Pp@-D@P Q (0S0  pcp@pcl0Pp@-D@P Q (P0S0Ppcp@pclp@-00@0`V`rPk `plpPp@-H@P| U (P0S0Ppp@pclPp@-`P@T [ T 80S00  ptpp@pcl,0\ 0S//O-Qap@T2 0 8R0匑=RdDWF pG 00^KW0 0NK@pT 0@ @, K0@z z x xp`T@0 KptP@- @@0P T S @T u@DP qP@-D@0S fP( Q  clpp@-p@`V PrKPU  0R0 hKfKPU p@@-@`pPK0 @@- 00 A @- 00  P0p@-P@P@pd`0  0pA-Pp`>K0@ 0 Pp`0 1K N p@-@P` P`V`P@T00p@- K0 $@-@ 0@$p@-@P 0S.  !U PE`J U V PEJ  J PUp 0@0p$X0@-   H H@ @ a  @@$8@-x@0 l R `P P zJ 0:08$ :088@$@-P@ P OJ0 0P  0$@-`@P 0 S  8@ @P)J0S0  $0@-@ M0S  PP  P0S Ѝ08   H 0S$8@-p@P0 R P   I P 800 J $ 0P/<H0RςB aQ B\ /< 0P/< 0 P /ȋx00- QAbQ pHHP@H @ P 0 0/<0( /0( /@-@ MP`pt uP P K0 S S 0S ` uP4  ЍOmP0p@-MD0  0S 0 R/Pm@ࠡPN fPBaPD `Pa@P B AyPލpȋ8@-@PPUP8ȋG-PrFM@A P0 @T 0@@ R@/U ̒F `n吀&a 吀 Bύ AxP5iJ.@xp15 S(T!\όL nP41P10xQ 1/@P T T 1S0C @1T ,FߍS Q  Lu+GuE? t =u1s SȋT<@-L!L1@T 400( 2@P QQ% qa0 \ 0 Q@001/ R ^ 0PQ@@ @ ^ @ T@@0 R ,0,8(;`pcTH$8$A-M tPp@p@X1<0S!QaWp@0VS@+QX!P00T0@080Q0C0!0ЍaP[P  ]gP0S@X T@ʘ@0S #0@=P  ?gP@Wp0@Q @l#0XpTЋthldO-@P M SГ#0P000 n3尣ßT @ PᜣW @P DP xCpSP@D`S70S4H#H@#@@<304#40(#($#T0(,$ 8HL04 P Ѝ0 0\O  @^ DPx @@@u!PTR`pB!@;! @p@ 3!T1@!1T@Q P1|t! @- P@@A\&0 R"41P 0\T0 @P @<80 P@\ 0^0 PP -@0S{=C0 DC@zp]Ћlph|t|Dc\{dx0@-@@@0@-P M0@s Tl0@Q \R A TQ88 00 Ѝ0 0Ћ@@-0S0"$  R@ ;j,p]0@-@L L00Q0QP/$ SQ/00/ptl0/p0 /tp/0 R 0/tl0 0(\$0 0S 0/@tplH H@-0S00s 0ltpP@-\@ 0P`P0000P00`@pP@-%@0 0S |Qlh\aQS000S00`@tpcc\{O-Q1MP @S _TP6xxq R\.[. 0AQ0S0 BSA }0 RV  0"0``0d0S \Q `R  tpغE-PA0Sj QPfPUqF >PZL 0Nc0e=Z0P! `0J S  R 0` 0 S   `0 S 0`` 0Q>PlP R `TpPFP 0(p PptغO-@PP` P`pVUYuP ` Z ( & p8@-@T0@ P PP l 0R P1/ 8 P}`@DpغE-@P,MP_ >P% 0S!tŸpb 0pR @@ 0P pt pv PY 0C ppPD^0 T a<X`P P X TP[n@TX0@,Ѝ=P 0@T0 3@P' 0P1<T`P T0@@@Aq0  p( $B(P`%@.0*X0@0 @  p8O-|QYW P?`q@ 0 Z@`#[  0@@Z`0@@` Z`CZ  @T+5``P w@ @T @pغt@0P@- < 0S 00\@ %c@p c p@-L@P@000@ @P p@pp@-L@P0 444 p3p@0  DO-PPM@Uڦ<P|0SW <E ``qT P`VG }0^<`U)[ <P`U <PQ% d Rr<`PP V Q`KUkЍ ? j6   pt 0S ' cp@-`@PN0@@8pp@-P 0S < P' 0S$ CS$ PS& 0 P P|P R<XP< PQ( Pc<Hp$  000/ cc@ 000/ cccDc0/ c<0S P,0  / , /@ c$ $0@-@ @6 cc@-\@PU !:@p``:7 0  PXغ@-@PP YP U@R@-@P 00X@-@P 00X@-@8084 440@ P@ ctpl@-X@0S 0< ,,0 XtpG-p@9`v0Y, PU 0S S`Q 9 RP f9~PP `O 8< GqPغ@-YP L@ 0R 4 4@W@P غp@-@PV. lQ0sH F@D`0P: T` S;@DP1 `6P- @T`GQ0 Q  \pq 0 Q Q Q0R  pV V H@ 0 SR0dp@ S00؋Xctpcdlp@-@PPpLQs0s? @D0`P7 T S@D`P/ `P, @T Q q 0Q P Qp0 P Px0R  ppH< 0 SR0dp@?S00؋Xtcpcdl@-@T@,@-F@-$0 0 cc@@-L0L Q< <b[ 0 c@B@@-88@0@, @@00 ccp@-A`0!1R Q2 00 C R-S= P !0S0 Q+ h0pT@TpD0/p41 @T@A @  p P0 0 pQ00P0 | ph0! p@``;0`@@Vpp@c c@c8@-PfT0 @sP80+ 88@-L@LP.P FP WP80 888@-0+ @-(0(!  @ c@-@L0@0$ $$&c c@-@ $$0@    @/` 0 /0/@0S  ã/$ \ 0//`0/`0000 S/ \/` 0P/@ /`(0( R  /`DD0 b RQ/0\/܋`p-10P S \ P1S P/ /S@PCTPp `Vpp @T U PU @T QU `V @QU `Vp pWp1 pp `P-/ 0PS @T P ` pSPpPW `@S@ Pp@`pS0C0`$0 R0   0`/`0/`@-<6@0@< \ 00000 0`@-l0`V @T PPpP@TP`@-@P MP Ѝx0T 5\pP`Q5  5a`p@-@ `5TP 5@0@0`p8@-@P PP 50@ 8@-@P P P @@-LP0S @`@0p0 q@R`E-H_X8`@-QDM0pSA 0 S- 0paS! C\M ``P!? `0 ލ 4 $!00 0BDЍ24S P #0S C`P`  \ P ``P D0 2  4 0 `l܋P P $ 0R / WlO-P@Up `P @PK 0$ S U R &SN >S (S>U<U $U@<S0-S <S@@&U $U`టVPX P @PU `\U0 S 'V @U DP @PU>U<U RqO-M00 0S0 `p S S  S S 0pSЍt\ WW+ g P@ R 0WS` pR 3 p q`0S p  30Z P@Q @PQ @Pk @kP@l pSA-Pap\ ! @a@`3 @E0 : $O- M`PPp0 @T @@1SV`F`ZJ$V`D$ZD`VZpT `DT`X `T`T Ѝ規᪏Z\ p  V 0[ 0 V 000 pp Vp 03   p 00 V       V 00 2pzO-`Mp@P 0  0SY SW d0S S $4P0S \PQ0SV RP 0RЍ A PHf2V 00`V 0  \R\` `V 0 8\8 0O-4p0MS`  Ѝp@ S -Tp@ 00D  S@?Tp@  T P Z0 T T? :T= P wP50@S1 S/ Z ?S+ P@T& 3Pd0S 00<   PPEP0@0@0 D Rpqp P @g1T`pPZP.  0?Spp^ BPU &1`XBXrPPY0IH 04/P002_p PAqZ PA AP `P  t0sPp``; S0`VP aP%1   pp@P   s0 `aP P `PB1`Z0(l@)8)܋O-@TMP`$04 <@@@$10H` pW2P Re H0S @ T'R"R HH@pWPK  pLDLpD@MpN@HH@pW  :R0 0%R+ *Rg $R -R: ^Rn0 ^R^R*ROQ$ $QP000H Q02$0  TЍmHX 0`p-V V 0@P 9(  :^i0gSaSZH0&CR\ C                                                              h  <           H`x`H`H :^ 0PBSHP`P qS x\ 08@iP -_4$H0 0 C/]P` /IH @`H`.IP ``H`H`q``H`H`0H`H`/1P H `H`.&`PsS HiHX5 X+p ,p p 0PX* P U PpZL [Q 0S S S P S SP0pS PPPh/ @ <0 a g 3Y; Lȟ @B,AP,x@pZY0P#,[ (H 0$ H 0$0 tGS 0H 0 0S0P@H  ,8@ Pt `PhH MH`V0P؆pW H`pƟ 0H/fP} P KƟP Dx 0P&8P! 86 .0S0p \R Z00şpWş0 &R0 Zڤş#W@H@xpHH R  0L QH00A0L [ 0Q00$Qn.@-R  $P0`$ H``Pv.``0B \Q  0@0B [0 H`$\?  $P00~Tf Rc 0!'R0 R R R  0RT R 0O  RL 'R0 R R) R'  0R@? 'R0 R R0H< LH <0PHꊠ -05 &Qp.00"L2 - -`9ꊠ -%0-'U @H 0SE `\ 'Sb S S S 00S6 'S$ S S S0 V, 0S) 'S S S S0V V0V 00 000 0'u(H 0I(H 0D0CF@eQP 0S| y0 $0 >]-z8`<lx|O-QTM@Z `@TH  C-@@`4˟p 0SI S@@D@ `p`.PQ P0UP UP :pW: V \U"Z- 0S "U`f' VS 'Ub \U @0Sp`4pWp0 J@, TЍ'Z W@0SpZ ,Pɟ0SQ 3/Px`0pWp P>0P@@,$( P @ 0HT<@P P$ U .P RM ( P_ \n 'Y! \Y "Y0H T 00@  P,W` $0S@(@^@@S,`@"P@D=S[\T SQ> wP9 0`S@ 0SP0 @0 PPP0P@P0DPp 0 1 @PDPp 0 PP2p 0 PP3p 00 PP40pv 0 PP5 pl 0 PP6pb 00 70pW  0   8pL 00 90pA  0   :p6 00 ;0p+  0   dp  0 0?0Yp0}P @T,R0b0Ӏ  q+`k0T"@n  PHT\@P0S= Q9  0 S'S 0  'RR0j Y+  HH0LH -@Xh &+H` j \HQ #PS H T8 0@0zZ [Q nP  j+ H2H @Xh0〰*H`j HPP* @*`*1:s  p 0 00S  3/P L H0`PNHY P @Xh  *H`0k H( (LZ$Z'Z @0'SS@@w*` @q*`@k*` $ ( `08p@,HW@ @l@-@P Fe*@P \̀pP 9P` V*@r/00$ `P pꀾ<=x3O-RMlS@P-UpP DT `h[0 0-s@ YAp0`[@pQk Y0 P R 0p0p`[@0pUp@P h^& `8q `  ``P 0R Q \ 0`0 UP`KU0S  Ѝ@P ^ p`[@pY0 P \ 0x0p0sY`p@0Pk ^h 0a0pc0S *`*`DU0S*0S` 7UA0 0 G-hM`"PTp@  cTp : S U`hЍ*`*`UЃ 0YX:T*`pP  UTXi@H@VW*!0DVW*@ \ ^`F3 0屠 `F@T=`a ^B DW@1 :.W+*@ P @F`D \ ^ `W*-\Tp@ ` aTT` ^2 0  `2 0  *`0 S2`   `lTZlO-|Mp$"PT@P Sp $ S R )0p`0JTU ƿV ¿|Ѝ`)pWpT6T* 0 P`  LTP #T Z`#`3W`X V @ " l@0 `Vࠣ࠳Yࠓ^@  T RQ`0D2 00 ` @Y$@pY@T D P RT \pD pD0S  R X  `^U I Gp 2 0 `F l MO-R`PMp@Ѝ0S ࡟0S W   Q RpC / ^SYH[3 0S@i i@pTY 0^ @Y Q @DHTpG P pp pp PY R Pp@^ P 0W t r@-P@p!`"p@ @@- a R\@ T@@ P @/ P P \@d0p@-PMU@`@TЍp d 0PP@p O-pMP ppU`(UpU#@  d0 f R0P [p@UЍ0;0P 000p0pE-P`UpPU@ @P@@UdV0  (0SV@  eO-PRM   p`@ @T#  c0  0SP Z@PEUZЍ P @PEPU> P  P@1 0@p8@-@P#T 0p p8T0008 T0008G-@`P pP $PW  0RW P 0W \0P  W@-@P 0S `p%WP `p%PA-@Pp- 0~S4Q/Q( %0S/S  pP  p p0B0 /SS G0S 3/`P  pr% |P.  At%AP  pU%.0S 3/`P  pȼWPo%p}O-~M`P =[% 6d"X~X@ Y P00Pp PbQ_ @ P@D @ RT   됱pPY/^P`T W- Q* @Q%  oP # %P @P'P$ R#  `$`[ P/R  Ѝ R@ p p$ 0 $ `$ a 0 P / "O-0MS@R\ Ѝ28/]T0 }T )T ( `SJh P X P `VHJ@@XP Z@ `FVpHT 0WT0 P W P Z, `HGY pXY@ PY 0X\ @ SJ @ @T0W R SJZp @ @Z @P 刐@?͠  l P0刐 P`3/ 0SXP]{` `o[ l0XT S  r@ غpP@- `` )ƬPP ]¬}<< @转4, )㹬$ ]㵬} @谬xDc3h0 0SS  :S0Q\  R:P//@-0PPPF@!Sp@0 @ R0 D A0 @ R@.P 00@D@*PP `5/P0}#WCCap2@7ǠOpdrdW،`pG5/@WpW @D5/TD@N5/5/T @Ƞ\(p@wS MbQ@-  iO EP- MP Ѝp@-@PM' QE 0SO S:SL ^S0Q@ \S 000S S:S ^S@0?S0000SQ  Ѝp00LS`/V7V0`F/\17\0L1@0@0L?S 00 0 S0  0S S:Sd t0@-0 RR0 :R \@ T  P~R=R@@/- MDP ЍeP5O-$M xl`P 0S&\e@ 2N`P೉T8O R00 T    k 0PPp[[ @p 0@XZ0 SS 0 SSSP& X i @   dRN@pp3UP i PX\^ #\ \R R \R 0 S0 S R0Z Z P Mm\ $Ѝ|R:R( \ \ :\  \\ :\ |\0  Q0 R R \R Z Z |R:R [ 60S00 R  R \R  R p R :R  R 0:R tRc[ R  o& b 0c 0 qM\  0`   wT g8 /S kP R 0:R  R0+@PP`` Q `   tR cR 0 婸=<ll0 0SS  :S0Q\  P#R / C@-  EMBPO-,M@PPT0(0p` 0WZy 巸 P0U  d0Q0(p@dp` @ Rk %R  0%AM\ BDBDBDBDBDB`EDBDBhEDBDBDBFXFDBDBDBDBDBDBDBDBDBDBFDBDBDBGQ \Q00^ \00Ѝo  pp PU" Q 0Q \Q00`C Q!`` 0```ḵ O-M@P9P Q P`p/ WIP(: S[ `QЍ \/ X Q  00^0յPM PL  P pPP` P0< Pp ີ P`/ , R0/   0!Y  IP( ^н/ 0 ƽ hP@P P P'P"@-lM HPlЍ: SO-P M 0S `P P pHpP hUPP0RP PP SP P P Pp$崠  P p p`V0ǟ@T,1pP  P  (K  `,Kvp``(@P ,P T@0S0.S \S .Q @T `R   Wl vP 0S^ Pyp ,yP q R Ā Ȑ p`@ P  P0V`SH @PYP ` @ p`W7Pu KMpp塴 @P`p PWC up T5PLpW pT 1`.V@ U'`@PȐĀ 0T UPf@囼UP`^TP0z `@pW QPxp  V 0FV0 0Q 0V 0 V! 0U1 T@ӳT{ T̳u@.T"0.S \S.\x0SH(0.S \S ,0.Q0 @ꮳP`z `@p0!!\[, PZ00Q @ 0 `@D 0~僳 R .R@T@`p@*,`(.\0.S \S.^ @AP  ⬳@ ⧳TPPpp D/    KGPQ8M @Pp`  PK DAR2M` @` 宻tTP`p 夻  0 .Reg `@a0S% .S^pW Z  lc GU@P .R3@,`@O-pM%P@P2 /мPx$ ` MP&PU Vᷲ@L  *Q 0V P TQ    RPЍ  *\ `F0/S00 R  0S d S Q @!.`@ ^ *P? ^P,RPL Q! Q !R့PPB 0S D  00@S0D<Q 0P @2P -*\0S  `g `tP& 0 0pPP @P  RQ l1^ XQ0S)PYV*^^/PP!Z X*\4^!N0߱Yر@ PP7 ϱP1P.DZ P*ñ P$PP ` P  P 嫱  <=PQ/@PQ/ -0S P*`PpU[SD (S6 )S7 S 0 @S Q/0 @P]S :|S000|R00S  @0PW Z 0P S# V @0pG @0`WWX H @0W0 @!S^S ``p:S.S =S @00-S% P$*pW@P[SL (S= )S> S 0`S Q@ WP 0`Sp/]S :|S 000|R00S `0pZ U 0S+ X`0J`0ZZY I`0Z0`!S^S`:V.V0 =V0`0`O-Xp@ 0 p @0@Sp .S1]S|`PUPU X  P R[ T[ P  0 Ã#t/O-PR\M0a R!:* @ p$$@0 (0  pY@ PP AP@Q``\ (R ?T 9*T Y PP )P`V)@ T: X  /Q=X\ ]RYY@ PP P@TT@ p@W[V4p, \Ѝ[T \T0W @S:Y nPP O@XV $.V \ 0X Y TPP!Z^ZPP4p p00F [W800P,(5 \W \BY 3PP OW Yp 'PP Op/W  R-W@P]U'PPP]W= P[W0=Sf :Sk .STTx\W \P Xn P\U00 SP00Uc [UO pY90@P]W Y OP IOPp0,\E TBV@ 0/V\9$ .V  R` X/ S 0/S)*0D?TS@T!TX 0pTp @R\ 0R0W :RpC ]ReNRP<TA H!<<D PQPP ,0L0H0p3QPD&-@PPH0@ \@dQ@ƮXW D^N QP_V 0T0 @P<崮TP@pWVW !!.V  R 0X  /Q @?T00*T   /V \Q`0(S [} Y  (Q WK @?T00*T  n /[ \c ?T XY*0 P%* 0P @@ P( @YIU * 0@P @Y;က@P Y/ 0*@P 0@P*%0N0P N0P /R@N`Ap.WTWTPu8P0p  pP ,\TP``R oNP M` XPG*[@T@ +!@\@@0T 00S (R PQ ^ ANP MZ Y 0S T 0S +NP M V Y "Z0 0N0P M0V3 T; Z0 00N0P |M0VJ YyT^ 0(S L P  R Z0 0M0P ZM0S  0P+ T R (P mPQ Z0 M0P 1M0S  0P( \ MP M Va  0PY[V @7PpG P00T0D0T0A R (P TPQ ^ gMP LZ;  0mP34p,04S  ( ]S B \SQRW S 0[S@=Q:Q .Q 0S @\0Y "A? 0P[@Pv YT ? 0PKPg Y`P`P@P\ Y 0?`P5@ 0P?qOpTpTp0 R ed4p,@|<P $PQ@-@ MP` p `1 ЍO-0$M(SH00P@ L`PD !EP#vssssssssDuDusssssssssssssssssssss ^h$Ѝ?U/ 0 | P TP e ,Tp 5B `% 0`|P P[:W T 0p! p1`lP P[ *T `% 0`^PP [:T p1p! 0p`Op P  0DP*U  J   | q T@ pd' 0p `&P P[|:W  0`PTp5p!  0pP T   0pP P[Z: 0`PpTp!  0pP T   0pP P T=Pp P |  `P0EP% Y0T!S p[*   0Pr [Y*0 S   0P0  0`Pu   0P  0pPPJ@P@P P  0`oP.  0`ePG-XpP p0P0PSp .S0]S`CT 1n@T P  ᷳP RY UY O-PRLM`0 RP!<*pP@$0p  0`@X` <0   a\ՅP 0(S ?V  *V X  !  0   ` VHp`PW:`U p= 0/S:[V@ \V T2 p02`R,:X`-  p  `  =RU]\RX@ @0p   A TD@ pY2[Z0@(P, LЍX Z UZ p,1.Z00S  U X $ $廐 J!Y^Y00,0`` [Y<(P`8 0@p P2 \Y  R @@X   R0AY X z   D /Y00 S-Yp$ ` @dT `fV]Y> `[Y0=Sp :SU .SDD@t8@@\Y  R` @Tz ``]V \VP`00Vl [V] X 02 0p  0af\p]Y,(PPQ WNZL p0/Z  RE .Z Z U< S U/P6D p RZ 0R0U :R@C ]Rf |P4D' 4 I4 0C ^  RI , ^8 | PY p \I d0 S\ X Rd L ^k @ Ps 4 \{ (0 S  R  ^  P D4ߨD0SpY ]Yz X9 0 ` 3 d` /* F?VR@V!V^p Up`p 0`T p !.Z  R  U  U/P p?W00*W   p /ZQ Y 0(SL Yz  Vڅ  (P TK p?W00*W   /YQ` ?WZh* pp*  0p AP) PVYW p* 0AP PVK pP V= 0*p 0PP*"U/\7p   0 0 $1.YD@D`v0 `4DBP00D0p`  \@Px0@(P0wS  ]S B \SQRS 0[Sp=Q:Q .Q Pp0#\W ZX    Q UD*[pWp0ppPpp0W 0q R (Q 圮P \ 0a 0Pd PV R$ W^D (\A h|PQ8 X  : 0    0! R' PV]Wc X| %0   00 1 S/ WP7 Xg 0   001 S 0P/X0  0 0   01 S 0P WP^ (P  PQ X 0   ^ 0(S HP \ X 0   00\ p\0[Zp~4P$0 e0D04P$ q0D04P0$`0 D04Ps$ p0D04Ph$ u0D04حP\0$`?D04ͭPQ$p0D04PE0$`&'0D0z4嵭P9$ ,q0D0n4婭Pw-p$0f0D0b4坭Ps!p$00_Z0D0T4叭Pa$` "Ġ0 D0H4僭P]$p'f0D0<,Q /Z P,* p?  0PP pVX p? 0tP pV piP V 0?^P 0pP?<`0@(Pp|UHPQ@-@ MP` cp` `0= Ѝp@-M@P`P  P  Q  W@寥孥Ѝp娥 @O-$MH0P@(S  L`PB !EP#@HHHHHHHHďďHHHHHHHHHHHHHHHHHHHTT ^g$Ѝ?U- 0 | P TP T pepB 5 `% 0`P P[:W T 0p! p1`P P[ *T `% 0`PP [:T 1! 0`p P  0}P*U  J   | g T@ d 0p ``P P[~:W  0`SPTp5p!  0pHP T   0p>P P[\: 0`3PpTp!  0p(P T   0pP P T?Pp P | `P0EP% Y0T!S p[*   0Ps [Z*0 S  0P0  0`Pu   0P  0pPPJ@凫P@P P  0`P/  0`PPRO-00$Mp@P0P0$Ѝ00kPP ZP bPPW ` 0 @P@P 0S \S  0"P5 T:0X0 p`P p P T0* @! 0 P Z   P  @Z   @庣X ᶣP尣PP @娣ᦣPPPO-pSM@`  $T PPT PP!᧹PX 0Sg \SS0Y0S_ \SB 0  ᢹ0S6 R; `P@ᅹP 0SE \S00  0 ᆹ R0 R PYce@P0  k0SPЍ0  R  0V^ R `@P00p0 Rpp  ta 0 @!TP  Q/t:Pkl ?o/o0B0s0 P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/PQ @-@A/Q  aB Qp 00`BSoq /oo @ r S?C S?C S>C S>C S=C  S=C S⇠ Q0 P 0 Q00 PP Q000!XAV8 `W|`!0-pk8P 0 E0a^0 0 R  P 0  P  0180;RmpBfP0R X pq= 8 !WPfni` H S488-! /! / / / / /!1AQaq/!1AQaq///--0 -*@HЍ/--0 -U@HЍ/--0 -D@HЍ/--0 -0@HЍ/--0 - c@HЍ/@-!@-!-M 0< L 1Ѝ-M 0- 0HЍO-M`@ p R+ 0S  0C 00 0#\4X0  RH R, R7 Rd R 0SP'0P ЍB00 p @h  0p  RR 0p [ .)0P  R 0SP P C 0(#\40T U R 0P BXV X Xg PU    ''Y @  0@  0@ X X PU X Xz R 0S#m 0C 00@# &_ R 0SL# 0C 00#̠   &~ Rp 0SI 0C 000#Ġ = j : R} 0S" 0C 00@# Ġ&S 0p\g 0Sk  C 0 0# 40 0"  0#P 0 QA  !  @ / 0 pB R+ 0S  0C 00 0#Ġ  0P  (BBEL0BSB R 0ST   0C 00 0#̠  Ġ&B  L-M  0 0 FЍ8Ÿp@-\M @@aDQ |30"1!H0\b R fPP0S0G01P:soQ6 K x,U  "DQ fV  ",1`V<T  4/P@`a DTQ @ 4/" f ,/.!S0e`P E@0S:?C:0UU +K!PP(PPC-PhM@,p hЍⰃk0 S R㐀 p p0T  +P0  P" SR F$c0؊ l< @-@X@-@P DD@@ 40 000$0@/((0$ ,-  02O-0MS* "ƒ S%*@T  `  0 S*Z@pQ`!`1T DPU PU 0 S:@`@@@@08A̓ .>p f r 0F@Vp  Ǫ!  p e5  0&0 Y,@8@4DƄ Z% hhh0V`3 0P` Ѝ N l8(0 ,($h/p@-TT@`dFa A04`F3/PV` V41/PE 42/PUp@6PPG-818@jIP` pI p DD=XX*h0 寅0pP @ p0R0S 0 .,, $$BȠ\@@@Q#;900  0@S0lL0P\,@0S:?C:0UUڸt 0p0 .pgW0p pp  0@S0 lS !(  ⴀ ,ᰐ 崐 )嬐 (ᬀ ! Ĉ ,ᬐ Q, S , ("(R040(  $  Q S$ $" ,$  Q S  0"# ,!<ĉᰀ  0MQ 0 0  0帠 Ā   尠P p ̐ IQ'Q# R0*P^ \x!\'\x 'T|Q pWQPQPRUI 0K !Y0, 0@ @ 0R 0 PXP @ܠPp{ ( $ ^8< @(Kd(0d `   Bv( $IQdQppiQPoQ uQ xQ XQP8U2 1U5 3UP2UPW|mXtjoQlg uQdd xQ\a XQP].'( 0p=ؠ @ܠPp '긠Pp 0( S ,"̠!.<̉.$ 4 ,ܠ P 尀P̠0 !@ @ 0 @ p U> Y 00#L,!Ă|Dp0#,!Ă<  R% @p0"#,,$<, q Q*@P% 00U  Y0 pp0p  p崠 P帠p 帠P$K  ,0 6UP4UPWXoQ uQx xQp XQ dLUPEUPAUPSUPTU P8U  1U 3U 6U P4U P }FUPAUPSUPTUP8U 1U 3U 6U P4U P aMU PAUPXU}P TPUvPTUsPRUpP GP BP6U =Ȑ P ,  ̠0 @ @ 0 P 0PS U  " x'ā tp'̠,,,t  R  q W| S!̠̌.ČqPUpS F pRЀP  "̠ T$ . ,TᴀPXpS  (̠ ,tqX pS',,!$|0t p 0 R 0SQЀP  Ā phP_^t|00 p嬀PXP T@ p^P,P; 40 @\@0 0#.<4P00(T \.H$DP0\.LL(D\0@ !L(DDP@0㤠 P !,P! @EePaT@ @0!1RP^0夠P $(004 LUЀ    P @p0',#̂\ .Č, tTWu qP ပ 0@S0pP t0@ pw ` Rg0S> ~@P 0  p ppP 0S p0  P2U P  P6U  P2U P { P6U v P q O-0 qMM ᓑ 㐑 %H @`Pa  90 m_K QOP  ȇDt0p4ğ0  pS  #QQ @QQ S   Q #00 0#@S  P]  PP S   P00 P000 R5:Sd 201 ؒP9 01 0   P< ! !u 0A!01 1c   Z 0W DP& K N P P 0 Q +2! A!P h0P1T0 1 0 41, $1 0 $< 020$0< 0R$<040$< 0Qc0   ! 1 ^ *!!!0\0 0 / / , |& - , , E-aM @0S:?C:0SK\q\AP RH R' 0:R :R 0R 0:SS0P : R 0@P  `0|P R0P @0S:?C:0UUЍ"a0 p|& ɐ@-`P6 P pQP@`@0U U  R UP PPU` H`  `P`0` \pO-@QPM`% 10p`0̡́ p \$̌ \ D  p0TW`pP' V'T 8a88880  \1 0T \  0B  \0 T00Ѝ  $̎`$ ̌` L  0 ̌ 8) ( ( `' ' ' ' D( ' X' O- a1@p S`L UD H QD @0 @ PH 0`Oz KP0Z Z 040 PH 8KTvPPM0 (0 T xU p2 P@10pUP040  0  - M2 Ѝ@-`P@pV1 0R RA S  0CR0 R RA  0CR0† 2/03/03/ RW |0|pS*P0.a , $0(`V T0 (08PX0 RT[ 40 0B ^a NX0pZ0S 1aC R`0F `@8qxW ` $ fZ 0d `0C P0pA WppW0C0Q P@D Tì`F p ]4偀p'p.pR! 0S0 pS0\ 0\0 X0Q4[01 0c@b1[ Z0f S 0 c 0Q 0吡BQz Rao0`e0``B6 B04Pfa0pb>wPp0 1 f`pB7 B0(@ P0Pa 0Lf!oጒi Y5Ys TI?M0dS>  laOS 0c\f `R0BR0 P R00R  8 0N45 p 8<DVUUU, 0rzP1(`V `0X gz(P``8^wp&0 XzP@([ ([@(08SQ< 5Ira_ |pG R  Q f1\@@0WppI8 pg0P`b35 14P8f@ 1A (YPb}څ5Xmㄑ ሑ<R0f3A. S R  3 S 3 3SBU0@0.QS  R 0S  0S(f Q0HP5YPDQ嬰ڭYʄQ  0@15YQ Hf ର5y<1 0<0 We<1 `510f S 0$0S 0 c C 1T`SX@&쀝Tp$YY01$0 5YpPd Pf$(PWv   0((xSpK*SKppc l P 0x'SPE*SPEpc X&(%88"!8  SdXS^ X0T PEp^p Y!U? 1o ii5\05 i5$LW^pX$8 `00AVY ʄ11Q p:fPp5y$1 0 $0d$ 1 b511 0C15YQeV00F(PTpP('hV @ U@@* U@D PeC  U@* U@Y PeHT o i5Qi05 0j4#!LjU08 0APDHY ʄA  0A15Y㈡A5iZ0  0d j41 !Tzp쀝$8SA a_3 >! a΂P Sf_% X  <ΌS(;$( ; $S( g\f!03a !0pTz!Ri97iC0(`V (0T008 aN#8 "0R0 L0Cca0ffoSMCS FP S @ S98P00C Pa N\_S )Sf c0lAT0] @[(T !y `@Mf 7i:됡005iY<2<0S 0 Cc!!!! 0<0XpG0pn5y$ 0(  0-c쀝 pI0q$0laO !y0l S!00 0 c!W80"SG <0 `47!6  ff@,@$@A R(`,`PUg8" \ B00 ^U, \`C7,0p0V X \30^.,0 R0Cp`0p iL i i)r 0$"Q 8P 00C ^([ `8[ 8 Rtt0 0P@- P| 0{X0@0S 4 4 0T0 ề0 C-M0 {Ѝ0Q@- 0SP0d0zX0@0S 4 4 0T0 ᅁ0, CO-SM0@;  m Q0@0PCT.p `PET`F&VZX 0VS0 QA P0PT0e0Q 0P00T: R 1 Ѝ0E [[ ( TQ QP ` P `0US0 1Q\A,0SPT5 `f V* 0E[[  T P` 0VS0 PQUA0S T P`FTPE f YL T`F eA- p@`WP RPPpp 7/0@sp g*spgpADl0E-SM0MPl0m<@ap`lpH<@PЀЀf봁XX`]*P0IHp@ \  0S:?C:0SIHp :ppaWژ  0P-03045 *xI P 4S  R 0& xhP5X\  @`0  3/T(h T$ 4S ` K  `  $Kl0 CZQx " Q%345 *x 5S40 $##S $01 ϰ r0NK A&K $ P -N.K B0)0P00Q0S000D  0D% 5 4   0jl Qo$ d,5S?% 4 0l0QS   a Q B 05 B S \  Q{ *-00x Q \  R 0F& x@ hPXs 0@`  KC Kr04 D4!Q $D$ K "HPG x%5 $441!Q $0$ K "$40##S$0`P x0 H l  05 4S=P0%RPQ D0  D0   :4,\$$@A`T P5s3S\P $r  XXZe $ $ RJ,%R\  X % xX& 0hPX$ X 0 3/X P!hZ,Q \  j% x 1h P^- \*$4**, 1MR" $@0BD4 004R@0T R@A0 @40R10  R' *%   0@  0R *@#@ 0@   R *'   0@@$  0R *+ 0@   R *-t4 @0Q    R *I00t# @P |!  0R *.  t < 0c@` 0^45A *t `@<P ` R  Q1 45 *t @ xuH HH+H;; 00J0 C R"z Z: @ Tv   M @$S̤ 1 CZZ` a(![@K k[4 00K[0K0[  K0[ %K[4 ‚K0 0[ ‚K[@0#  K [ 3` 0K LK$K$ K "C`P x!0hPyY0 CZZo a #< P $40##S ET $$INK D/Lc P% @S $ '@K k[0K[0K 0[ 10K [ 0K0[ [K0[ K[@0ÃK[0 ! 0 K`$  K LK$K$ K " `PĄX [ @`Th $SRQPI tw D 0X^cpQrJP\  X # xXhPX: X 0 3/XPhW^ \  i# xz1h PZ Z$R MM, ZEtؤ * Z4 \ d 堔d Ą t @p4% P ,0K Zp0S= 4SP4@`$4@PMP\  `iQ4Q@C T   # x!hPE\4`5*x: Q T  " xddd/d?~ 0 $ R@.d `4!1R)RR*( ( `1@S) S)  S  S S  Ɵ Ra 0 `\@d R R xQSj( ( Qi   R*0+  0x A 4Q  Q*+00  4NKXS   4J X _H5S\XT ^PQ  X X KXP 4z_%\  R&4 SppW  4S  \+ 3 45*xc @  XZ00$X _H5S\X~T P00Q0S 0j{  X r $ X 0`o $XQ00^5%R00S PppW㼤 0j  N pt  0`$R Q+345:+7p" 5S  R 34 5: 7pW   xEhPp 4"  o㰤 xQ 0 S 3 405+*x A R X | xXu!hP ! Fx! Ad!  <L!   54! 0$! +8  a$ " $0\h l  e%R$ D `% $ hS(0 ( -S?(0(0 s\  0Rn*  xX L 4%d%N&* M< %% 0!< %Nl&d%p%Q  Qo* 00S2(0 ( 3S(0 ( SQ($( 01 (0(0  R  R R( 0( D 0$ m( 0(0 (0 ( Rr< !1-(0 ( V$%(5XyS*(4 ( ! 5S0` \` Z`%R`` 0 D 4 8@ Qd `  Qs$@M@$d0K8KlpppPZpp(C(C8ET` $0$rR^D  |CC剿@,(( 0C R %(5(+ 0R01405*tH @000C S  P0` 4 Q  00C0 0B QS $R  R*0  0 0@$\Xl0 3/ PhZ갤 Z#   #M4@ 0d ` @ 4 4 RTj0K0 b4K 0lp $ p]8@ \ # \0@M@ $8K0Kkp8Q %$ l `% ($ 001( 0(0 !SX(@0(0 Y  ` D  Q0 3 45*x 0P545*x~ 90 S0 3 405*xs P545*xi L X /?R`R@d dj %\3pi[S3p`0 S405*xW `X% X%PX% RX%@PH  (8.3p;X% '3X%pU30X% 3X%pC+Ss,E+3pY -X% 3X%p%3pSRs, '7[` `2p402p$De"PAPIRP 0@De"(@0(0 &6%2pI02p: X% 2X%p$(0$( 2pC02p44S 4 l `5  2p8 l ` xC1S ş1(K M1 C1pL .81pF 0< 0W` ^45*t5 `@<Q ` 1p) X 1Xp!%d%&p%M `7|夐 Vf  4 8 [xp|@ PpD ESxp|@ PPL  0T FTD0S0 `oiZL`o 0c PDPP0`p0L` p 0pDn 0R*  ph  W^Z`P`LP *DD0LP h Vt Vt V`P0P q a@@Sp@ T 0PSP `a0PS QL D0`V` P@ |`1 ` | `zP C 0 CL 0PCP LP` L 8K 0f  8 4 CD00 PCP L D0PQn D|d1  `Z 0␠0`aDh$ܯD  P@  ` 0 㐠Ee| @ uğd `$0<0 `Pc`0$<0 `pp!p0 g&0pZr`pT#T $` p'D0嘐gYSH |SZ| d0Z2b:| cN!0HZZ5&p@`B/&p+`< (&pP np+&pPf P!`-ZpqvEPp dPlEP  `광1 `00 , 7p1p%pZt&p81"`0``-p%p`+ p p-@fY px WpDD px J|V|0YpxIPc A 0S -劐ᳰ  =初Q0X JPHJZ`` +⫲X @%;WW \0S  \q P\0S  Pq P\0S  R*q P? A\̟ 0,1F =0P4 $<ح00S  0 P  =0 Q„ \45* ^45Z* 02 Iߍ 0=!4 L 00AS80 0쐍4M 0,APNK, L\ *,0  0#.\b *P #\b*C0@\bb:,  , ,0 0S0010@08\D) <D000SxI0QH {  0a[ 8R <98QAaA0<<D0D^< { F/0 J ɟ<0 H^#4 R P  Fak0[``GW 0cK0`` 0XV4 R @ Wd \ R  P* WC \ R  P*0Wu \QJ  PF*|P  V0P^ W0 0 60PWq \QT  PP* @ [*Wt 0pJ04``0 P45 *` BR4`m S [5 0S 0N \"P1 0[*J  9R K0 ,p 0 00S: Q9R E \ !eR p 0,<W  0 0X> zpp $0< 01p$W  0K 0 [ ]WF \ R Q-345*WK \ R Q+345:+00pP 7WC \ R Q 345: 00pW  a ^ PY 0\-345:-0}"0p   R+34 5:+0j"0p ^ 3 45: 0Z"0p Q0 3 45:00J"0pP  Q 3 45: 07"0pP < bDW@ \Q+ P'* + ~W) \QH  PD*-p p 0, !< p 0币10SH @ 1eS@<  Q*-I Q*+@\Q  Z* p \[b  a R W  `E 4`80 `\ ,0R 0S*q\J`Z4`80)D> = 8&<&Dl&< << 84&\&L&̈:6 5 X5 1 &&&- <- , , + *    P45* V`  iY W0 0 90 PW  \ R \*qPD[-+W \ R  P45*0W a X \0 S  R*q PHrDX/ <NX1 10@D h@0D30!Q145: 0 !0p,, 02d@0 @ R(X<<10@0 Q*@ꔲ  $< 0=0r'p!p000p~-00p  0  0p7>0Dl#l  00<0pp ( 0QV$W  aP  X 00 S 405*O~ p00pP*  R4 5":0f 0p00p\45:0O 0p 8 80̎ 0 00p 0/  0p  +0! 0p p@0 0pP @0U0p 0L0p+0C0p-00p00pYj00pXb0!0p-00pp@-$qP @0S:?C:0S.@0S" 0` V F@Q@P @0S:?C:0UUp  `;P`ꯨt0 p,( --M0 0AЍ Ѝ/-, - M0 03 ЍЍ/̖ -- M 0 T ЍЍ/--M0 0Ѝ Ѝ/--M0 0 Ѝ Ѝ/@-H`00CS00P @0S:?C:0UUJ 0pA- @ ` pP P ` p P`@ ` p`M Pp ` $Pp `0B Q0PL U   0A0PL UQ $\ p 0 B)R1. - - . - - - . - - - . - . - - . - - - - - - - - - - - - - - - - - - - - - - - - ,  pp R P  PP  *R 0 B RfP .R v 0   0 0 0Ɵ 00S 0LA0.P1 1 1 1 1 1 1 1 1 1 1 1 1 1 / 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 l1 1 1 1 1 1 1 1 / 1 1 1 1 1 /  P @ P  P 0PA Up p0 B0A \p P.R   *Q 00A S00~ 0B Pp0p 00C0B \0 l 0    0Q 0A B,7R񟗺2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 42 1 2 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 1 2 2 1 PP0@ Q 0B P pp 0A0B PQ $R `Pp`P 0  lR0 0  0    hR   z w ,(  ,( +(   .  ( $| P0C00 0%OЍ$|(, RP$` (  ((( ( !( ,pA$ppP%5p A0L P  0A \ p!p 0@0A \P $Q @Q%50 S i`P` cA pWp%5 pRpPR   0\_ HP0  U8\ 00( XPD"@0S:?C:0SY$ P rP!@0S:?C:0UU:ʼ V !0V V ';0"0$P 0P @0S:?C:0UU 0pt0 pEBu@ H`P0ES00P @0S:?C:0UUt 0p͠Ȗ̖ЖA-0MrS`t wSe aS d2Ϥ0 p ЍDRKmXZ ;0mSY S +S6 0mSf fSjp0 002 T  N Z:@P$ XHp0: |10`PI 0A- PPX +XZppSqrpp@mXP0mS@P  _0+pp0+S mS+SZ 0;! :pjh l() )L*A-PPH @IH`'0}@S  0S:?C:0S4H`p 08/P H`00CS00P @0S:?C:0UUt 0pA ` H`P0ES00P @0S:?C:0UUD 0pᦟE-Q MpP_X00O `IH`婣0@ S  0S:?C:0SQH` `  H 0 `P0 & !倣  Q ` `H`p0GS00P @0S:?C:0UUp Ѝ000` ` pO 0pp@ H`P0ES00P @0S:?C:0UU&븤 0p , <0//l\ \՘ ՘Ÿ/L*)@-p MZP`?9@PP"  H 0 00` 0P`P <  l0\S<0՘08040՘0Ÿ0 Ѝ= 8Pl()L*) E-P>A@IH`Ģ0}@S  0S:?C:0S=H`p l0S0l0&  p \0\5*8 (P, P ( P5*8lQX   $^ E-p`@\PaEQU!UP!U%U  J0"! S  R   0 S  0 S@eT pd aD\08@-l0@S  \0 R:   (P, P ( P*  8WP 8p \0 R*0^ P1/8lQW  0S RE-\0P@ Q  ! \LR 0S; P5\0``  R. ( l   `(A PlJኁZ.pP \ a B\ -\0 p`$`  A.P \0`$ (\@-P@Q`p <0 W00`P<0 a: C'\<0@-M@ "0p )0Ѝ\@-0@S 41/p\ 0@\p@-0@S PkRP P@1/ 0 0|ЍH  S S;  S S8*P!0 0 PP\*Q D E 0@S S  Q*S Rc0S  W 0^0 c  BE 0@S S  R*S Q c0SS0` $0`S:0PD@-0S0q0!@0S:?C:0S'aP @0S:?C:0S+@T0U `P`~ @ \0\4~t| 0S:?C:0S ḷᵷԖh) d 0  0E-0S \$BQ\ 1a~ Q0@@ `@P @0S:?C:0UU@d VXT @0S:?C:0UU1~0 p(~t 0pԖH~ h0Sp@-@M`. /Ѝp P 0 U*00  cU*\  cU* c cU:@ @0 4R0  ꊛ|++A-A0< R`7 0Q&Pp7/ Fplh0 ``` 2/PP 0S 3/0hP`p`PdfP[*   @`T`Y @0T P `P @0S:?C:0UU 0d@ē \lЍ _ut  0p eԖ/,?P0A-M@Pᜣ TI3p:T:dQP ` H1`~dp 6S pG@@ 㣦P @@$Ѝ㒦` 0`]p @?fN&*`Xf|UFuo 80`:p 4\ ]"@E-pP^ @dVI P @0S:?C:0S @dVU #H0S:?C:0S= 0S:?C:0SP U rXT"@0S:?C:0UUP2t0`@4"0S:?C:0S` apFl-Pj @`@H`H0? P 000S PPQ= @V@@@ 0H @ P@Pe0 c0HDDDyt$00@ `@ 0S:?C:0S(L@_LLdXT @0S:?C:0UUNtt0 pEt0 pvw (lP`hW V dO-!q,Mph \̃   \  0!Y0@   LS@<4 S ,Ѝ 0 S"*8 L1  Y< Y Y 0 tΟ W    HΟ4S  `&S&U8PP 嬄X[ 0# Zn 増Yw Q~|P8d 0P `͟$`@H0@娑"C lZ 0@ `` `U  @XD4X 0 SUb PR @ X(&Y68YY[( Yln Yuw(Yz>~| @ T0`` 0 %X*  `` @0KX *@0 +;0X:00@`0@` 0+; , 0 40S$ X \+lXD H ` ` `4`  $WppR PP 0  h* ` V_*`⩢ C?@FHaTT\ 1Z%X ZXX $0B`@ @` *:5 YC?`@0@ `0`V*  X_*=h W L4S @0H1 R  P `P `P Y@ 0S@ @ Yl 0uYr @ R 0:0SpX"`0`W<4ST 0 hN80,( 8 8Br0  < ZQ@ 0 c Y 0V` VS @ R 0:0S Y 'p70 V x'L70Py  0Z U@; 0 Q P0 0405 Z # % % Wpp   0W &|6Ts( D,& Ɵ 4W   `S  0  j $pB\%s:xt$ Ro` 0@@S:0@0`VVU V   %5X|%5hd%5ğ4 W $fYUڢ @ 0 YN YDk D$0 dk弴DH$YH00X@ W l   0  00YG #4SC  \<p  X Pß # % % W0pp  d lT3PB D弔 D$`F PAVPă0P000 0 `00TT 0 S 8#2_ \ "2V0S0  0tY# s S00  @0@@@e|@ lē 0  f  Z D P5/PP 0S 3/xt$P4R T[ P P$5410 0y [rkP0c 0    P jPZD`@!`1D 2/P 0S 3/0 kpP$PPā< `F0 V``  ,"1/Y 0P0'1?t0~11~4N 1D11102 4 4 p1t05 4(5 Ԗ+@2, ?C  <S& ^ < 00S 0 Z3 P*P  "0 pP P 00 C  0X\ 9/,,  "0p` P xxx!x13|刑t|0$S@ |4T Dt4Da0@0`o ` Ps %V0 00@0@@@~pA-`+ p @0S:?C:0S,PE P @0S:?C:0UU AL0Zo0  To0 pᆨB QG-@kQ 0H X 00X!rU pWPPǃpPb0GQ- H h``F cR` c bA8q TC p    UpbbQ  0h0  ReT PPln  G0ppp5,?@ PA-`4Pq: P!u0 q @0S:?C:0S.P T P @0S:?C:0UUAAn`  L0xn0  ᮧpnt0 p$? ? $ O-MM0$0 H @ 0S:?C:0S @P`@  0S  0 SB$pL`  Q@00`\8@`Ȁ 0 Q 1 P !\` `Ȁ?p0尐Sppp  Q1^!SQ@ T`PpP @0S:?C:0UUp P@ 0 0\@@0 @P0P T\0SP @ S\ @ P T\ @ l0SP0S 08 0 @D$H4 A 0@ 0  \ 0@$J 0  00  0 ЍۍO 000.P$l0 P4  SmT 0pp兦56@6|6$7l70Pp@-@M @Ѝp@@8(0$<0,040(000$0 00^h`P@TU,($  84 00px77 RO- M@P *@Tmğ `Vi  0S:?C:0S\0DVဴ * PjY1P @0S:?C:0UUXF PH :%::30S #3- 0S* Q R00Z0S  B"1SM SU S   S   S    Ѝ}`PP  "V5 @0S:?C:0SC P"@0S:?C:0UU|X PH 0H"H<02   c @0S:?C:0SlLP$` P!@0S:?C:0UUKV P @0S:?C:0UU l 0pQ ^P 0k0 akt 0p!4/PS  ЍOmk4p 0yk0 p 8 ?8,95 8O-0 MSP儴@K T RkP`V=  0S:?C:0S05  A 0a KP @0S:?C:0UUsZ  J0 "** 20S "2 Ѝ@U`1 PV( @ 0S:?C:0SY  t P`!@0S:?C:0UU:Z (yLP`P  P @0S:?C:0UUk 0p kt 0p  4/j0 p.Ԗ3 9,?O-0PS}@Tㄴ"j `V9  0S:?C:0S,@3  zP @0S:?C:0UUsX  H0 "** 20S "2 `P @$1 PV( @ 0S:?C:0SX  p1 P\!@0S:?C:0UU9X VL PI`P  P @0S:?C:0UUCj4 0p:jt 0p  4/+j0 p]Ԗ40 9,o?<1A-0SPDPP@0/%::a` @0S:?C:0S-P @0S:?C:0UUi$0 pP QpSS0Óhp4Ah3/3G-@Ti`V4  0S:?C:0S' zP- P @0S:?C:0UU H0 "**20S "2 m`P  LP V7 P @0S:?C:0UUn("@0S:?C:0S] $ P!@0S:?C:0UU`SX L P#` Pl!@0S:?C:0UUBV P @0S:?C:0UU i 0p4/zh 0pa0h$0 phd0 p,`ht0 p+ :,c0@$A-`h0s" q!@0S:?C:0S0XT @0S:?C:0UUA|P R AnP hAht0 p( h 0 @- @n@A-Pp b @0S:?C:0So1 <   RT  PP1 Q @@0  @T@ @0@ PQ0 PĖĈx$lT $p(t4TĖ44|thD8t,Ĉ4td$tDT$0Ĉ<@D$H4 P @0S:?C:0UUg0 p,XLAELDTԖ3O-@TM `PЍOgYX  0S:?C:0S   P&   rP# P @0S:?C:0UU J0 "**20S =-2 Ѝ茲 X8 P @0S:?C:0UU$"@0S:?C:0So  % P!@0S:?C:0UUEZ LTU Pt!@0S:?C:0UU8-P  P @0S:?C:0UU'g 0p4/g4 0plgt0 p\g0 p:fD 0pu,$ 9,?$0 p@- P@p@@-@!1C00Q0S <0SP  3/!0O-S4M∔] Pa<@<@ @0S:?C:0SF@$P@ 4 $ P @0S:?C:0UU%@d@ V0 % ʽ ƽ|$½$|徽0< < 4ЍNᓟUft 0pԖЖ;;<4<L<h<E-@`QPD4SLp0SDZ*U!*0QD D XAP W W SP :0Sz 0hS V   0V `` ``TTT"T2W  Z+*HP$ J^0[  E"1Sp- SQS S S0000 0 0 x!V  h  000@H!H<1 0W !1W  00\#  0j0 Xc0 0hS^t  M|p lDKW00  P0PPP@<,m @(=<=8=<Ԗ<+E-@qTPE@`0  PX0 40C  0 PX f 0!p@ @ R p\l L0u`f``ėhP U TT40 0d@-, h= ==`3O-PU M `q3PQP @ kX0!z PUPPŃF(::Ԓ @0S:?C:0SBd@0  dP @0S:?C:0UUq0S)  C0 "**20Y !1`` Ѝ6P`KU PP8  K` P-  Kv@ 0S:?C:0SE !P @0S:?C:0UU' ` ,@ Ԗ>p@-( P$000@p@qO-`M P Q ࢟ @0S:?C:0S y P"@0S:?C:0UUXr p!wY PU 0Ń 0 "@0S:?C:0So@"P8U00Ń X[. P!@0S:?C:0UUP Ѝ<PP0DU P EP  D   @@ bc  0Wc0   /လiBc0 put6ct0 p  Ԗ>@-"p 0SB\0 /0- S/  0S0/TX @%00 @, $0 0S 0 S S 0S S 0 S S 0S S ~ ! 0  "!43"00@-@DH L\ 0 ,ĠP P!#4 0 c@/  0RR! B/P-@- $(@P\ -%\0D03P, \@%T741P$̠2$̠P/Ƞ0D,Ƞ0%\3P,\@8P$ȠX$Ƞ%X% \0D03P,\@%\  P$ĠT@P/ PP!,Ġ%T B@P/ 2!P-PTX@-0  C 00 @ C  D0 0@ 00c4@P/   R/    /  R/p@-P@EPp p@ p@-P@90Pp   p@ A- @$PlPl0a0Q`p P  p+A P(p Ak |7PE-@PMP`0T Q  okPЍ gk # 0 p:W 1 ! @7W:V`00F dpgR ! NL|7T@`0 2< Č Ȍ C #0 b /o b/Q0-e #0 0S0X RU 0 c K QKP@A@@ \ \F 0\= 0\9 0\5  Q01@00 \ \, 0\# 0\ 0\  @|0|0 \ 0S @0T @0T @0T  0QS``0/0R0- 0%"A0PsP3 SPU50PsP3 SPU-0PsP3 SPU%0P|P3\PU4@T R 0 @S@S@T@BP 0 0 s 3 S R  l0/0@s@3 S@T0@s@3 S@T B R cRp-0@c0"QSPE0@0 00S0 \0{ 00S0v UH T 00S 0k 00S0f 00S0a 00S0\ PU. ``V@`E 0Q 00S0L 00S0G 00S0B PPUP0; 00S06 00S01 P0UP, PV % @B \  @ R@ T @@T B BR  R Q Qp/ Bc p@-@0PPP0pp@ @-0S@   \ S@/0S00@-S(@$PN 1p@-SP|aU xlMP5@Uå? @T3 BU8 4qi0c .cP@00pQ  p@^i,U Wi`  c0`cP@00pU@T@T `0@Pd@P\@ XP lPl lL x@|7lQd@@-O0S @0-@P`\p*p X 0f0@3:) 0`@ P\p: @Pp Q0 Y g@ p @ P QpW 0!!0/T@ P@ T@ P@O-BMM PA. @0p@0 S@T# B`0DT4 C0Q 0B0T$  B ` B0BT$  K$  `Pg @ aD @0G `p8PcTa ^B. 14Su V0! 01S#* \b   0S* ^ R\N0^I0S: V*0 0Qf  &@QRATBL @@C\P0\0DV: @`S:``  @ `P $ЍۍV*RYG PI B0 `S* ` `V Y0`gZ10g `DG @ `PT \B.4SNW"*0QC  0 0S* \ 3^/0^*0S:z ! 0 R#0   S[0CQJ K RS B\0CRSA\ B0C Q*q0  0UO-0$MS@+ R ` R S 0`S0S $ЍYPP  @dT U`dppeT` 0m !`  P{ nfF` `PV X0! 01T#p \S   0TP C\?0\:0T[0  0Q h  p`QRAVBL @`C\P0\0FX:`X  X*pRWI ^G B0p  0fS01f F p `_PA[? T# 0Q0B  0 0T \ 1\-0^(0Ty  0 R"0   SZ0CQI J RS B\0CRSAP B0CQ*  0  0v` Rp-  0S 0B R   B\  0Sp/ RT0X B{0B %@$ $ BP, @SCT @SCT @SCT @SCT  BRX\ A %@ $ P SC\ SC\ SC\ SC\  BR9@0a%@`$@&P @\T @\T @\T @\T 0@`%@`@&P B @S T @ST @ST @ST}  BRR B \ R  BP  B\fd~R-M30 00\ 700\1 B0@";@ T V*p@X`PV P `p%@ T lQ R 00\@B 0 0\ Ѝ/00\0 B0\ Rp AW `dP~ ?:Wd pEC8V U p `P@ T T@`PCVp  p`@ T pCW ` P_ P `p%@ T pP8[" p ` @ T }@`PLVpf  p`@ T jpC:TV U ` pP&@ T SpL: [P P `%@ T <\@V:  p`@ T ,\p:DfY( P  p`%@ T P R@- R+Q09 R- Q` R Q@Q`QQQ1 RQ `r l 01@1P1`1p111 0 @ P ` p   /0q@q%Q%0`@`%@%\0q@qq0`@` R` \0, W R-Q` R Q@Q`QQ1 Rx1, Ġ)̌ ('t&|d%lT$\D#LS `r 01\#  R-Q` R Q@Q`QQ1 Rx1, Ƞ)Ȍ ('x&xh%hX$XH#HS `r 01\#  R-Q` R Q@Q`QQ1 Rx1, ̠)Č ('|&tl%d\$TL#DS `r 01\# cRp-R 0BS  \ 0S 0S p/ 0C@T0@l`QT 0 P T 0@DS:`V0P1@lT `@D ڀ0 |0 x0 t0 p0 l0 h0 d0 `0 \0 X0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $0 0 0 0 0 0 0 0 0 `fV @ `F  0 0 0 0 0 0 0 0 `dV`F@00@lR@-@P&` \`l 0L \  0 R 0 \  @PP0\ @ P&! @P R BQ0 Q \ pp\PPP0@&0`Sp@-P@A:R&a \`l @L\ 0  R 0P\P P@@0\ P @&!Y DP@ Rp`BV00`pV 0Q0p 00Q@PpRP@$\`l L Pr0c P rQc rcQrc@lPl&!  `@fPfpBu0\d pR u0Sdpud0S u dp' `@fPfp0 \ /P 00@-X S 08P T0@ \ 00 @-0mXSR @8@ ` P`B^`U RV P\U R p aPV W`QUV R PR-. `8@P1`BP`%U# 0R V P1PU 0R Pp0a0V W `QUV R/@-@0DS%(m 4m dm tm m l m  0@ @ @@ R@ @  @0@@ @ @ 0@@@ B 0@ R@   @@/@ 0@ 0@ @ 0@01\- @c1 \) \ Pp7à@tp8`0 R p P 7à6dt`pP B6#D@/@P  @ PAA0LS&Po do o o o n ,o A@0 0 0 00 R 0 A/0000A@  A@0$A @ BA 0@ R 0 A/ A@ A @ 0A@ 01\- @c0 \( \ A pP7T @`P6Stp1Sd RP`L 5c p 7T`PAP@ BD5# / A@p `A`@ @- 0S@/DHp 0$ d0 ,\ 0 S 0S 0 S \  ~0- S  0S0/TX @%00 @, $0 0S 0 S S 0S S 0 S S 0S S  ~p@-@QP` ``0@PpA-@Pp`V'P  S  0S0PP^0S`F V ````000p@-PQ@`pP`U0PEp`@A-P@`pX'P  0 P0 PR RQ 0P0H@-MR:0a0 ϰ B0D@$$0D@$$ *0`0 S0ΰ(H(H B R:@ R 0*  ΰ(H(Hϰ0$@@0$@@00@/Rx:P`P l0 B_0D#4A0$#4!0$#4!Ra: P BN5<@R*W: RJ:\1 \  @ R$8$HH%XX&hh'xx( ) * +8*. @ R$<$DL%T\&dl't|( ) * +4* @ R$4$LD%\T&ld'|t( ) * +<* n R:P BN5<@R*^0D#4A0$#4!0$/ D0$% D0$%Ѝ@/!9R@-0&B,1\ @ 0\ @DT 0 @DT  0 B"02 R R R@/0S/S/0 R R0 l/l/p@-P APp p@0S/Q/\/ 0S0 /Q/\/Q 0/\/R0- 0%"A0PsP3 SPU50PsP3 SPU-0PsP3 SPU% 0P|P3\PU4@T R 0 @S@S@T@BP 0 0 s 3 S R  l0/0@s@3 S@T0@s@3 S@T B R c!!pE-`TM4 PTЍ4@Pp P(PP0Pp@ p$ -T0PZ pPPp`. '\D0H 0  5/PP P 0@T4 U  CP/p3/R00 PA-PPHMqDPS0QDP !@|` `,08$(`@BPS0`pW< T`<@0@ 00< 6/PP PPPPP \ ,0@T HЍP \ 0[< @dP P@ ST@LVHp  `p ,e 0[Xt @,AXAC8AH-aHM@H qS`PRX0  MTp, !@Pp`Hp 8P 0P ` 4` @@ XS PX0<0 pWE HP`U%0K  00P@K06/PP' PP PP P#@@dKPP P +ST @ HK ] K0 00@K K6/@P@ 88g 409[0 U,p p ` @dApAC0@-@, MPR S0T Ѝ0 hŸO-SRUM 0@$01 PC`l@P @ @(@ 8 `@ih`Q*< `8p (@(@ 8 `@< WB8BBBPBB@-@T000 ޵@Ap@-M@P 0 @M`P QʵЍp8@- @\PP @ P 0S p388謵ln1H-S@ x`V9WPP? 0\S  p/PpPn`M\ `  < \W  P  P PP pKh00/WR DS@aP FP4ln CCx8@-@L0P0S PU000 R   80U0 s0 CO-WMqP@,81DQ0Q40S  pRPt  AQ(AP$! I` P[Y[\V $A(!dN @U➰0@`   5/0P0PP P$A0P@ePPDA#PD\Tz 8Q\ P @PQP  R P00S /L@T00Wߍ P Q PP P  1FT$AP@ePPDA $`@PA@y8@ RύIU0008($a/0 00  5/$1fLAP PP P 0P0^  P 0P0@D@h\d X0SXH D0SH0TD07  01(  0S@CCCAC8A  @-M@ PTЍNp p p/1;Q;#;P;#2aR # /q-$ 0S "QڜR A5A1B0ϠBLB10Sl0hBS $* PŸB$ @b @@/0@S B;R "L$R$WB^L Eb?bcdPQk JMSU P0ᬡSP 0jP` pR C0lAj`!?`B"c\:d0o 0cfS``R0F1La/b1 cϠ`F1lc `R0`B0S`0BV PgU0  \ 0 V\ 0\ h 0C$P ?dpc QƒcQ P3cnQoQYQ*$Ugfff$I@-`Pv>@` p< (v 7W 0@ SS` چ HR $( `R``R`S``d 8@-PeQ` 0S -S+S 0 C Rm K-S  -S+S00, &K*K(K 0 pP( P# P00㸂K02K"[U0 (7P<(00S`R`[[[ 0P 0<SM0 0I \ +P -P >P6eQ1"(`-V  -V+V  <  0*`Kp` pP P P0><0 0S ,S  R <0( ? 5pUPo0,S00 JR 00B S0 0V4K j40<%SPQJ P^F 䄟0/SSL ,S;TP$0T,S0JS 0C \y , 4K Xj40ğS PQ,P^ (0/SS? ,S $4800D0R<vMR R !/S0S  0*`K0 p` p P P P X3KKK00/S R *K 00 @ pP P P 2K "K`bKMSe S `c3`0c,00^ 0:,0A ^o[["[<0 <[K02K  0B P&~ $̌ZQ 0 pPi1Sf Sd1Sa S_!R0 YR[< [Π^.[0}2[<2[^#t,4 0 20pkP=3S: S83S5 S3P0-2[.R2[Πn2[< [<,[0[<2[n#`P `H` $`̆cC P C m  D L p@-4A`P p 3Q RpPPP垐PVPP U`P 0SP :SP`UV  PpUP``(` t0\p^ LP @ @<   ( @p@p@clD,D8DA-pPMP`W T @0S:?C:0SVd!VUHQ0 7 P`100 0V U$$P @1(0 Pd# P 0`00TP @0S:?C:0UUЍ 0` WG0`0NG0 pက 1¯2jdH aࢯC 0S<R8 8D8# $0, f0,@`T00S*W5 T0\   000<p 0 ȠD00 !$8 R Z q< pJZ b  Z @q<Pb @q<Pb@q<b` 0S<0R88D8# !$0,H f,@`T00S07*W T0\   00<pȁ 8D#Ƞ !$008 RG Z q< pJZ b Z @q<Pb @q<Pb@q<bDt0Q0@0 0ESE <0\  j B`TH LpOOOgfffQ$I 0OS& ES5 D @ 0R8S8<0D !8$0, f0@`T R4 ,*W3 T0\   P<p 0ȠD ,1$80S Z  q< pJ0 Zc  Z q< R c q< R cq< c4` Z<R1D 88$0,l f0@`T00 S,[*W T 0\   00<00Dp$8 Ro Z q< pJZ b Z @q<Pb @q<Pb@q<bR 84 L R8 P < 0S R1 4#LL R L,,0@cT0 fS*W T 0\   0000p4Q Z L8 q pJZ b Z @q8Pb @q8Pb@q8bu EZ OQ <THv. OQ EQ D0 @ u R@D 0fZ*W T%00\   M0p0<,@X4@@4 0@4,H?@0l5Q?B1c!@l0 S jHH ER <T00H0 0ES <TH OQ EQ D 0@0 EP T00H0<0l P 0S  R0S1 Z. P@qp` pW  PPqP@  PP@dT<0S ,x0PP ЍPPcP@-@M@Ѝ0S x R p0S \U0S 0SA P @PcP@-` M@ Ѝ0S 4!R ,pW0 @T!QU WP0 p0"P0PPPU @0pWA p0S `@-P p0@ppppppp@P O-0MSPT P pW` 0S QF ЍO쀕XA H^ 4 [[ P @`6 +\  0 Pe`$0 P(,X4@P P+Q  0ЍP c  R0^P pD pppppppAP 8@-0@SP  Rj0S8040 8A-0@SP  RW0Sp `W  0GPR@R RR \VW40U @RmPR RR @\@VW40@R%! PRFR @\@V40@R%! PR5R @\@V P\4PRP\` \PVR P\%PRP\P \ʲPVRPP 4 @R~? PRPVPV@v\js@VfoP\{ʄPVw@\VP\V @\C@V?VV P\MʻPVI@-@T0000 .,@)@-pQP@ ` R* RUY 8P UY3iP$ @P  N_PWhp4  0pL :_   @PZU lU  @-0S dp p0 P @4 3 က30c 0 H T T @-0P @p p0ᘀ0030  03c 0 TT 4T E-`1`03pP @0S:?C:0S90@0 0 S: 3 0P 3PP @0S:?C:0UU P@s3@Q li34 p0T XS R E-` M @0S:?C:0S$L; Pw00A3P @0S:?C:0UU X -3  Ѝbl$30 p,  > ` p p/1( <p p p/1@-gpp g@ p/1vO- c$pPU3 _LQ @ 0S:?C:0Tp @0S:?C:0T0S 3/MPP `U P᫦-T@0nT4Xd 0h@xp p:P=X$Rn qT$ `pV`ᷥHppp寥`᫥Vt1 `U `  0 R 2/0P`U! $K`X4S+T U p0S 3/p` F@0S:?C:0VV PU0Q p 0p88 4050$ 05 ,; PtPP`P@-`@`0 p p p p=- b 8-pb p: : @- p p0က c'- 09 @- -T4 SXP pSX@p p/p-pp/p-pp/p-pp/p-pp/@-p p0က c, 08 `0@-SM  0Ѝ p p0 , c0d8 `0@-SM  0Ѝ p p0 , c07 P-0 S' S#BS~S ʬ S  S,0&SplS d S} T S #Í S4S,T/'h$X7 x$STsIeRP-0 S ڰS ʤ S S@S ʀ StB,0&S T S  I-S4S , SF3NTFSJFS1sIeR{Q46 TSTP-0 S ڤ S ʘS SS /Sh,0&SHS @ S4 S ,SY)SJA<5 E=(NTFSDMurP@-M! R  ЍⰀp p0%P@ p pP /R  pl+0&S  1R0 Bp`+Wp + c  BSFXP3 4 3 0@-0SMQ-      l       T       8 BOZU^Sߍ0BOSUBOMUBOGU Rl1g+0Q08 t t    | l | 8 @ 8 8  8 8  $ $ 8 l h(UPl TP \ \ -+hUPhT + @PTP,&P00P2 1 1 1 h1 "P@-@4MO ڊPP%ڕP> T񟗉t% D& L& T& \& & d& |% |% % % % % % % % % % % % % % % t% t% % % t% ,& % & % t% % t% t% % % % & % & % % % % % % % t% t% % % t% t% t% t% t% t% t% % t% t% t% t% t% t% % % % % 4& % % % <& t% % % % % % % & & & & % & & % |% |% |% |% % t% t% |% |% |% |& % % % $& % % & % % & & % & % t% t% % % % % % % % |% |% t% t% |% |% |% % % t% t% t% % t% t% t% t% t% t% t% t% t% t% t% t% t% t% t% % % |% t% |% t% % t% t% t% t% % t% t% t% t% t% t% t% t% t% t% t% |% |% t% t% & t% t% t% t% % % % % % % % % % % % % % % & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & % % |% |% t% t% & t% t% t% t% t% P2 Pp p0bP p p pR0, ,NJ,0U 0S SPB p4Ѝ赎2P$nWP$P !*B p $ZWP$    hc 4]W2]   Y^WvPӧrl)  @ ^]p`V)Wp^ d4 O) cO Q* i,Q* h* ,2@-P\MP@P) pTU WR DB@D\ЍFP GP.GP. Pڰq)p  pEP!1P]pCP>P 3P. ?PN PL ` < "#p FP+p q  `0 00* +p pPڨ P PpPʩP Pp p `0TpL pD}{) LQQQHQ`QRQxQQ0R$Rp p p/1- M =VP Ѝp0 S S/00 R 0   Q/0S  dd 0S R RQ\ ,S// /0 S3/1/0 S//8@-@P8P" U@8P@-@T X-\$M0 \ $Ѝ/ p p`    000` `p R@\ B  P @ BT@PU  BR @,X ` O- ,M` PK8pK(K@ 0M 0r@P "P B (0S  @     KO- M` 圎Rh , Pp( )Pt&U 0;0SX%Ġ 8#Ƞ%\P4R20S= (K20S7 \ M0@0 P\  0S PR 0 R  0SPx B KM0 (0   (  PhP (M @, ` # !Ġ  $K  !hoP0  P Pi Dh` Q 0M `0` D,` ]aP8 0SS   S P@ Q (Kp R @ R 0 R R 0RMP 0PP0   ~,P@Up Y l@ lPR 0@lQ[ l0p W `  (PU5 l`` `d @ 00(` $ (P`U@ dP%  `0@ W`@ 0@`r (l@@l0l0 S ,0e `%^P`@ `aP,@80S S,@ 00 SW,@ RSPP|M 0Z PP0S 0P DK lGD Q,@`,@`0\p Y0   ,@  0 @4 Tr Tm hH0SPdUPPP$KPP!`@ K80S @,Q` pP z ,@KpP lp !Q0  c吐  0M 80 QN P Q P\Tdp^W(M` d ppR \n q,@0SqfpQ  Pt P`P (M h, 00SP S S,  000<6 ,0 s3SPl p  0l p l p  0 Y  #    DK'nP+D \ HP ( pPM0 ( mP0 (M,000l 0SQp0d  780@ p Wp ` ` > tTQ4 @7 `P1 %PğP dMp 0M0T * P|@ |4x K,Kt d p l` p 2e`Ps `0Kp0p @Kp  06/P p.00"S4@0s90 M Q@@Plxp0宐W Yx S 0Sd 40^ P 4 @0S``d`  @0S d | l`xph"$ 0d| R\* |r @#P Qb@0s SHl`04d`P  l RR00C`0pKD 0 嗈@ KDK 0  X K6/00"S@~0M \@@Pd`tP @Dxp3Y\  M >x W l0  R00t d p R0SC R8 t RX   t`v\ txppppWt  PSSd  T  TT ,  T \ TTU UTX l0 p\`pDp 0p 0 K@KDK 0@ pX K6/00"S @ r 0 M ^@@PPw SYd ltd0Pt PW SUl t 0r03d v4c`P& P @ ` P,KP(M R    P Pp , l Qp@0sh S d  S``d` @0s S lSpp dp 0r03t dSH pWE `dP |@ p ,  `QUq- @T(M0@@00V P  l Q @@ 0H X00  l M 0H dP|@刀D`x r3VP5 T`pM d` x * < p\`0@M@Q PP Rp`d P00\00SZ  Y>ppS 0PS``/ `LH 00@D`& /(p3@D`& #p Y U  @TBQE`$ , y$ <,  5$ ,  V $,  8 Y Ẳ 0S ᵲ$ g $  r_P00埲 wXV0     \  p  t xV@RSxSVpVhV + ,+ L`@O-@P IMP, ` 0*S U *\ RDxp> R 0S@UP  KPP&K%K0 K40K&K0 4 %K o  0S" S%[\ U R0SS<  Si7Q,P( Q  ,,0MP0 M0P  1  4 6<,PU `pK@$A $!ppK 0 Aq 08 , ; z#!"$ Y W \Q ,1 $`` `K ```` Q0@0  PP\ aQ WP5 ` ` R! 1SH,@Q 0P! aS(P  RP,0a T(A T T `T T0 !"`# $0 pp Q@ p 8K HP <8D 0S  D HK.,  `! @ K4 P41P@  0\! WQv3l h0 p d 0xK4 09P "#0$0 WRz pWzQwptq,~.!00` ` pe%[&0[\RS pK\  z`0 p! P \L LPK  2I: 1, !0 0X, (0ڰ, R {y8 ,0ɰ `lS0e S&[P|0嶰Z!1"x!@0S:?C:0S SQU @T!P0K0  090P @0S:?C:0UUږt0 pAOK )DPP 㴾P hLd L0"\N ,P,HtTL + E V UHXXV,X 41 R D R @ R < R 8 !R 4 !R 0 !R , !R ( "R $ "R   Q  \  Q  \  Q  Q  $R(  # 0pXP|7X0@-S0C@S  QP0 *\S1S @/ 0 /0S S /0S \ R0 S P 3‘P0/0S  P 8` S[P  p(p\RV:  RK (0P8KpW LPJ [ qw ppPpWp  p[ y P 8 RP 0]\p(p0S00 S00 S004 0S p(pp@-P` @R P R R4/Pp0Sp UP R4/P pp@-`P@4/Pp0S  P4/P p0 SPp0S S0 SPp0@-0@gP 8@-@PZP0 P8A-@@MPP 8`  `p@pP 0U000Rp 0pЍ 0& 0`P 8pp @8`@-P Mp@` 0P P0  0PS` 0S S Q@P Ѝ`@- M0 0 ЍG-`@`p5 XC 0S.P 23*  0 0P` 0 0PZ0 UV-  0  0 0PX`0  0P`  0@-0 MR@0P P  R Q  Ѝ0P@P@@-@ $ (0 S ( 0,@|0A-SpaP @Q@ R0S ݫ۫٫|0pSl|p@-PP 0S@``ī @P庫p@-@崫 岫K0S@謫@-@娫妫夫 墫堫垫@蛫 00S S/咫@-8@-P8P @僫T@0@08@4@z@8A-`P 0S 0@@T0: cQ @P \P! V0^! OP@! G U:B@>< P PpP!QR@0@S(DpPP %* <P AZ8@-@P PPP PP8p@-@P@\a! ` 0p  0)t\\S]A-0 CR7x ty y ty ty ty y y x x y ty ty ty x 0SBXp@X@`U PPV@ ``TPFU?p q aP T( pP@@P0$  0 0 1 R { 0Ar\\\ \0@D4@ 408 4 0, ( 0\\t ^\\\P0p@-S@Paᆯ0P 0P ~P KP$PprP $Pp p8@- @RP  Q8 00X P80 A-p @`PP!\\ 0P!0\Dp P``q1QA 눀P 1A-`Q@; Q8 Pp0W:UM  E0APp Z\& 0C BPEpJSP!`0A`  R ppp\@ R`F0C BppͮpP Pp0SZ!ḽ !᰽0A-S@P Q  P00bPS5 U!Q.0A!` L B0C ppSpBL0C GH0Q 00A !U 0`Aa!  UL0`P A-M@P` p `ap- 0 R R  `P 0 R1S W Ѝ 0pP0mp O-M p P@PE0S=` ![B0KT@  P6^ 0T:  P+1T  P#1TUs  0@zP`Z在 ЍU  P P 动UU0O-SM  O  RL "@P~ @CB PE ^ 7Y>J@ ^U!1S20E!@ P1@DS0B 0E #pBWP U@LP Hs`CP0FAZJYJ0 ЍZJ 0S 0@ 0@N@  a0L SRP ^`  R@D P ^`0Cs! @ P  0 P0@ n8@-P0@S)P 8 !800008G-pQ`/ 0S  VS& R.00P 0@P@0 AU# T0!RP@ RV PGG  T  d !ᚻ0d0e !፻ eO-PM@p A P` U0[ NP$ P  PPTP U'0 1S    1[ 0)P Y "P P UU p P  PJ0R CR0!1\PpUPЍO-0` M PS@pH*p1 W1 , 0 3 Wpp rp 0   0 100000000000   100000000000 Ѝ\pWppꆀV$ἫP a 嵫 寫 嫫 `姫YZ VP 0 `@-Pa0p@yp0{ '{$` 7#{,0 QO-M8P@p 00 RK  aP Ps q B)^ YK  B1 A.!Q  R0C< !Z.$.ˠ UPd`0 `pY  pPS0p R `a0  yp? ! ! SP6 p  fp,  CP&   0PyP Ѝ 0Z`Wa Pp *[ ?p  P` 0 PO-傀 ,MP 0fP` A  0S 00\Qb 0\] @pS<  t` R, 0@\0!`a0s0@\  P 0 0R Y000,Ѝ&P 00 +" 0  0P 8@-0@SP  p 80 S8 0ˠ ,+Ā8  8P0O-S$MPt0p$@WpW2`W+@0S d800 p0S  @r B!@D0Tc S   `0@@W @@$ЍY  S  S PRQ@0 0 0P0R^ @ \   0  0\]]Q8@-@(00Q? PP$P 1PuQ0CJR Pu Q0CJPAuP0Cu NQ UMP 8<80D 0  1  S 8F_U  P R 8 8@-0L0\ \  S+ ST0@0Q X $$K$K    B0<3T0@A-PX @d`VoT P FA@(t;Tp#;5 0S[Q  A@.T. 0SM!A@!T!. 0!A@.T.Q 1 W  P  X S  W  W  P  XQ  W  W   XW0S P G-80(`@S00MPӴp@p p P0SV !r \W S00$ E_Y@P 30 pGsW8 l 0 H ` P p  ̛ 00`V  (` J ( BAP( 0 0Ѝ0 `V$00ĥKPmpS00pV!P;E @P_UPPÁ'0GVSL 4  d L 4  ܝ ĝ p  00~ X00x v 0S 0 _W  @30  ]<4^U  Q \IE3^ V `V Q  1 X00*! X % 00  00   X00   X00!  00  00 "00  @  !00 #00  00"P00   00 1pGpP00  00  00  7 $0S8 !_W@0ÃS !~ pW | LQ p pxxpPPpz pnXX  $0<088 $0< 04,ذ8@-@(P(8A-Ȁp@`P 0 S! S,R /RSQ 9RuP 0Bu00PB S PP0 SPPP0O-S eP e S000080R ePe`8 0P H^0(0$ЍP K\P HP|@ R $0UP @ 0U 00 eভK0 0એȀU 0SUH  XYQ< qWA ,4 ff 0X0 8L0 !R0H1  \J \ 0AXZJ @ X!!~%0 c! p 0 pw q S0 X   P K0L! eR 0 0R LPP RoIQ& E b R!@ R  NQ [) 0<0XqK0 P [zH X*   V 0/0 h 埳0@pCM0S0P0KS0 000  \,4L000 0008< PP0f{0 C<0 @00SQ 0D  0 Su K0<YS000000 S.!0 ?P_[w0x00 h0 0hP030#p0 S 0r j{ 0g PK0SX  Qo e!;  e60  e e  0  g 0S,4f f 08L MP$A-@PPPCdP $0 ءP P9 dHP0P6S9@Q/ 0p$ W pW&`  `0 `` @@`@`0`0W 0p  SAY$0p@-S@Ph`0Q0 SPpVpdf!qhPpO-P $MR `p 0BS  Q @0S A0 SD 0 @ 1QDB 00S<@ T4@@T(@T R RJ I [ 0ZJ 0H\J PH 00S 8Ҙ@P|  P{404(QN p p0 0"t.{WS9 4  .Œ "S4 = S40@040W) (Y8  [  [  ^ @# Q XJ0Q C Q 0!S0X EP$Ѝ4 040 㭛P( s4 0409 00DO-0@SPT*``S% qQ!RP1" |0Zᄰ (|0  !R p| `|0S=0P|0 0O-SM 0P` @ @CR@ Q p R@ p R p@D !Q*C ` R `VpS `ppWJ 0`FZ0pG\`F  R 0`8㲗pP P(\f0L!0PS 4塂* S4 S Sp  0Sk0 SGU Q R0RRt R p" R 4 4 0 S0Q RP 4P奂* PRR4PT RZ R Q R 4P 4 0 R" 4P奂* PRR4P40 S4  PRЍpSJ ` `I X` QP4! R P4 %RRP "4 4040P  R P4 %RRP "4 4 44@ 4 4@P4P00Sp 40! 0240T 0Sc 404^4 @040Z ՙO-@MP`0T7pH tP0Pd 0[Y  P7 ^1 PP pl p W刀pP @0 p劙0 SWЍ Q?  dghd0PP NP WP O-SMPpK0Q0pl R  {0P`  0230SU`[@P\= QD  R3  ]0P" A R  S0P8  0  0S-@`Q!  R  :0P  00S`[@Q@`Q`0[0@0Ѝ O-@DM @[Pm P``V_ 0\[ AtW 0e!@: @\0s3 [8 ,Ο 00$^0p ,0 1pS4p bpeW00T00S[$ @DЍq @r @\0[T 0@ \  0 R @0 a(0SI,0SFQCP . 0SU `R`@TE\W: 0R 00S \  P PP0 @` \00QX  0 X @r RoT@m1X X 0S ,P, Q   ;P cpX00S  ^  S@\ @T @ ^ SS  `0XSx `@$@` `Tt` @  S`\@ `\@  \`@ S \: `V' @  S P@  P@ P@ S @ P:@ $0 `S00pW 000 T(L 0$@p@ $0(,48<(\( P( R (1 80PP  P@` @`( RQ Td0`a^0 ` W  `0 0\ `R. B P:0PQ0 \  P:PQ0 P:0P P: 0PQ0$  R 50 0PP,80Q4 |QPU0 0RfaT RFlA V P^P P `P R:P`U P ` XP X`P R* ` J W 0^` 0W0` P ` V0 P0\\C 0 1`E ` h( < a `0QP,S `P Sp` W p W pW SS ` 0a Sl p\o pSp`\ `\ `p\pSG `\@ P# p`S` \p  \p`\ p`S  \: ` p  Y P iS0 ` p0a`@ ` p0S0 RS B0 ?S@@SRS@ PP0 0"?PTʭSRS@SRS@SRS @$ćO-T@\M,@,`xP@`T`QpP H,Y (@d`4d@(IX 0`Y` qW 4 D@  40@ Yx0S180d0  $ ( HQ  PTW* $ (8`P VpT` @Q煁0s P Q $P@T @垔TH0S   0PT  0PTX $ 0T>pP d0 p Qo x  R e,0d`0d`((PEX 4`D GPTd  0aPTlHPZ0T pP| d qS 0cP-d  Q1<Q 80A0PP8P=dP8 d0QgPPd @P0 ST0+kPY QL d,40P0d(0 0dp3\Ѝ  0PT @ߓ TLۓTPT D  TPd0 pLT\ ,00P,0 @ ,0 d !ۣO-P@M p8`0p`@|P Ѝl0p S2S t0B V00t0l ql Z!`l l  l !1 jx ^xl 岡 0cЍO!t劘0P p l t0 !}pl0ptF O-@TM`0T(T, 1( 40(0 T( 0,0( 1QP^ X %$;#;        Tl8lp t00#Q 0P|0Q!$ P P  R P0 $ Q 1P @R)p``dV  0S4  0 0P 0 P P X@`X@0Sg$ aRY' 0Q RYd1SQ \N pL p1 ^ 0\AQ p Q 0\6q0 S 0\.q1 ^Xw# Q  0 p@=P P0 S X P p@0!0@Z|  R Ul80S0L@@ 8 <@@$ PPQ@Kt0^ \p ,Z<  $  0gJX dp4  !QR 0R (@ 0.0PLV,@ Ldp Hd0 QF  R4 0^%lPQ@0@1XXcXA_XG[ bƎPW TЍ `X|s  iPL cPLlL, _d0  \LP H哑L0S 0-0P`00孖0P  0!0Y3PG-h0(PMU@pT` dhP!L ZR2 Ѝd1S R( EX  0( zP$(X A d0X (` P 4@ Pd O-` 0ؐ  P{tK 5@0tK .0@`p@tK "p0p`dp`thl l h0p`d p `0tp`xp\0|`` ` Xp0p0t p l h d ` \` Xp MM@ @ CtK {(K 0pPc 4ĐTP T 0LP H L 0DH @ D 0<@ 8 < 0\ 8 ` @@Q|`P,p T`K 1S #`0 \P T  D0 00S Q  0S   0 0S pW -,+`0Dp%V PW `VP``VP0S0  0 K0(K 0P P \ R (K 0PF(0SC =Pt0` dphpl0lh` pPd tp``x\ |P pX` p t0 p l h d `P \` Xp ܀P@ tK Ԑ0U  ```FPȐY(1(4j0@^ 啊T㘇 0,P@T P@儊㉇PP0p 0᎓[,TK!R ` P-PᵊP  0Sa``(QL ( R O- TM ^@<@ 8 PL @ H  0ㅊP8 @KH  4@KL0  QH@X 040 00 X0M\ ` X \A$ K00"P  R:LpqQS Q\ S`0S{ T`0+S(c  l lP  AH( ^+ \YH0St 4@KP 0@@(0 R,щ`\H K (0l lPC (pH ^A( 0 Tt! Zځ1(0 Zځ!R  \!r X l 忝 (0l H0S0`YH\ Z JP p% 0Z!R   \~ 0Z \10s ^10s 0ZZy P04`KH `@T`q0@C d0(4K d `P@aT QIp`B h d A*P@ vRp`ApP@ vET`WhQ0(0 p s Yx4Kl xPg @d(@ lP 00\M@dTpP@W"h `d\Ԉd P P4KhP H R @,弈`P \巈Hp0Q0( K X@l Hl0 P X ŜH4K0 P ,又`0S \劈H (p ɖP 0(+PTXLjP0\ `0 TH ,h`P \bH 0卍 P H0 O-KM((PlD@  @0$0TaXQr($p,pW ( P0!Q  R , (p(P10 #\ %\5 1Y4% $$0S! $p(Q ,\ 0P 0SY ^ (pT P@PApUHp  $pD\ (p P4\  P^P$巐@圐嘐\00lX,00XQ0ᤐ堐0rP$ 0`XS)DpSpx 0(```$`00Lp0`V0 ڇq R P H0S``X P `q$APqWP!T  008@P$\,^QL LpWy(4 .)PQnPPP0 A >h00S0 $0< !PSY !P U͟ 00P)U9=00S0 $0< !PS. !P U8͟ 0$͈0P4 Ȉ0PYU=00S0$0"< PS " P Uy|̟ 0T噈P$|]UYL 41 0 3 41 41 41 41 41 0 0 4 41 41 0 / 41 41 41 41 41 41 41 0 0 <1 <1 p1 \  0 pP ( 1((   00, SSz S SS (P ( pK p 0S Sp 0Q  (P0w03 VWX ( !\@$(.(>P$!p3p\Q p 0#\@$q-=p$q00pЍ 0 pP$ 00 \0S Pń(08 RS} qy(  0x0` VPp$ ppUP  g  05pPb `X[  0)0{03$q^00S  p,0S0 SS$ p 0p  WP4 PZZ P[0S,P ( p pX0S8 $q pd ?P S(P SS ,Q`8hDXP\@XP0X0 % 0SpPq 0!R\0S  Dy=(x$A00.,@$ 8y $0pSpW)gU$8d^\ ^ ,~TQ ,~U0PPP0긠 ` `X 0X̌ P删 P0̌4hdH X H0X Qtt  |PX$p@-`P@,~$ @($0S  9$,0S  1$00S  * pO-S004M? `,X`P 0Z hSh㈰ @0S:?C:0S0(0@Y$@T  U p@W@  @FnpP`n (0$  \ς0,  pPXUN ⡠ Zo Z Q: T@)00D Q 0  R 00Q  0   0Q  0\011@T: P㉐@ d0S `VNhm`P @0S:?C:0UU=4Ѝhm` 0cY 10r  r R P   ~  @Q m m\ Pk 0xGt  0p0@S-*@S+P P@P' m 0 , ,0[( $ 0V]\]l] ]X] O-$MH@p `LPTXP\JUT W  0HLPPT$ЍO@$Ѝ02m P  }0  0 @l-M $(, 0Ѝ-M $( ,Ѝ-M  kЍ-M  _ЍA-0@p p`lP P 00000 ` P`@P`\t0 -PP PPVlp p p@-p p0က cR 0t@-p p0က c@ 0,@-p p0က c. 0cp p p/1t;A-Mh`pP&@P   p 00Ѝp0ST R1  0xt`A@P  @|`{'x0`hoğ$d0  5P e \ 0S:3405*Q Ä0z  0t>*x0p @  t g\`  \<@ R0ßd  hT\@@x0@l0p@"0S:?C:0S 2RJ 0St00t0R"? PpP|"@0S:?C:0UUqx<Q eЍ # k&kZxt 9P@T   ] R xt 9P!Pi f H Dt &_  r<@Lv`4h 8p7@1npG0pSa au]0`dp`tx@V A@Px Gr:E02*t0 p E+X]e l _4_4Tc8^$__gfff,_<_0  -- M 0  ЍЍ/--M 0 Ѝ Ѝ/P-P@-@ʰ %Vp p@P p/1'4P-P@- J,Ơ%F @Zp p p0/1404[p p p/14}p p p/13p p p/130- \ \3 @T0 P- @* @\@ @ @@ @\ @@ @Q  @ PSU,\ @ @ @S0 0 00 000000/ S0 0  0000Qp@-@`pPU 6/Pp0p@-S@P`  5/P   5/P   5/pQ5/pQP/ p@-@PP P 5/p@cP/O- MPQM( ,  K`V p0@(0(, 2/P T `X00PPPS@p^0M  w( (0 s3SRPQ(T D !0 R(0P( 00 7Tw Q 0u D 0Sr     00@Q; 8 @T @8 @@@ @0  0 0Tc{(p1q  R@p0_ T M  00 4 bw400Q        0 @T Q 0 0     00@Q  @T @ @@@ @  0 ?Q        0qO-QM `> 0S   P p p`@T  03/P  0P X00P Sb@P @  U   0Ѝ@-M M0*`0)PP! zI@ @p 0 P oP:OP@ڿ*&@tg& Ѝڍ0D_T_d_O-`@Mpd  Po80P V_0XtTS Ѝ TQ VO wq @d00p a p@jP8 @ do0PV,0kS0Ck   p@Cp  so P0 V   p p@,T@@I h 0$q0`php a p` P ``PP L0@~`f@` d@ {d@vx___O- M  @pP  P1!DРP@(@ ,@  p`(pK,KjP 0A P 0@/ Pp K~`f`t p````(pK,KejP 0@ $ Pp____@- MUPP`p" ᎗@P 0Sx >jP@ bp 0T P`t@PS Ѝz`__ 0Pd/8@-PQ8@T8/k0P@  8@- M@ 0p p0P ?  Ѝ␀ 0c 0 0@-@p p@ p/190Vtp p/100( <Hp p p/1$0@-X pp +@ p/10p p p/1 0p p p/10Vtp p/1/( <Hp p p/1/@-$ pp @ p/1/!p p p/1/| @-@ ~pPP0S `s`PUP gPl`q$(Q/0 03S/! 1S/ 0,10S/ 0/ -0$ Dh  Ƞ !$ 3Q*Q  3Q  03.00@ S4-0l  Ƞ !$ 3Q*Q  3 \ 0䄭x -0 !$ 3Q*Q  3\ 0 -0    R( 0 h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, <P -0    R% 0 !$ 3 Q*Q  3Q  03.( $, 8X -0  P  R( 0 Fh Ƞ,!$ 3 Q*Q 3 Q  03 ( $, @T -0    R( 0h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, <P -0    R( 0 h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, 8L -0    R( 0 h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, 4H -0  L  R( 0 Bh Ƞ,!$ 3 Q*Q 3 Q  03 ( $, 0D -0    R( 0h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, ,@ -0    R( 0h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, (< -0    R( 0 h Ƞ,!$ 3 Q*Q 3 Q  03 ( $, $8 -0  H  R( 0>h Ƞ,!$ 3 Q*Q 3 Q  03 ( $,  4E-P~ep@0L`pPneTp $kPh$HQ 0 03S* 1S  0,10S   1<//0-,!BQ(#R3#@-P`U  @0S:?C:0S p0U P 0pPE-@jP0, p,pЍ 1jPh,p,pX TK 0@ P,  oX@`|7hO-M Qq@aT -bg`1@@f 00 RU  ,A^N l P@#QQ   a@ T( $ 0P"ЍR+  Q#Q @ 0P 'Wt W$ L, 08$ 0, t`|7 aȟO-0` $( ,0 pP@GM````````````u 4P P P尴 P +&P   k|D 0  00@@S0 $0< $ğR#R 0 pd` %iP`W3  iP_W0{  iP_W0p  iPp_W0e \ hPH_W0Z 4 hP _W0O   hPD   0@EP!U(W %P{  P I P x0ol P \0gP P @8 P 0$0 Gߍ_W02 !  `RR   R6 R: R) 0 /@T! 0S dd 0 ^ R&  #Q`   0@ESP!V 7@ @$ , $ |, @aTa0` ``,`<`L`\`l`da|7haaaab0Xad<0@-S 00@(@P  0@-XM@Q$ QS00^ eXЍЀ 5!1`SR P RTꚑ@ @0 RP 0@ R \ 0t0' Ѝ 0,P H@T% SH01/@T@`0S r0"\\`0S ~ t-H 2/@\P`\ 0\@Pn`Pp @0S:?C:0UUЍ^ 0 phtdd@-$MpP`Pt p) @p0S  WS$Ѝ4 P  pUT@-$M`W@P :S l PPp$Ѝӳ0<p R & 3lTDTp@-P@I@0SQp@IO-M@PPP PPPPP^&  Q S RS RS:   P0b` VP PPS^IPd pWN `PVE UC0S?00PcU:0S7U5: \ Q R* R 0CS㈑爑!RS:QB$ $ R S :^B  0bS000PcUpWq Ѝ QP0 0F0i08Qp-pp/H8@-< 0 S@ PH0U00@8PPS@-+|# \$    S@t T  @t T  @t0@L#0 _@-@M PP  PPP᷂ `P  " PЍpO- lM@ PP0M | (P P|P,P ( `DPKD dK X`K pX 崥KKP L HKGKFKEK@  0訂p U00S P KfPLbtPKp p 8Kh `p \p ,K t l dp \p 10^ Qp P4 R\ P|0 SP:x  R0SS \ `Zx崀Xx , X#S+ 10 x^ Y Q |GHP  p|[ R   0\ Ʊ cp|GpP9GP|  9dNMLDLO-P ML P8K8P 4P 0P ,P (P P@H8KPF08K000 P>,@T2 40DP P$ R"QR * aRQQ \P pU\ \ \ aR@T D 18Ka@p8 K@8KWp8 PAU``\ U:pWL \ \pLW PlU0`  DPP D !M l .W,pPW`h@ P@U TZ T * @jT ZZ 40\ Q0S Su SPl D0@X hD圀 0PS㘓)0C˜PJ h0Z   h [X0SVZT: $ h@ l  fhT pd \ ltd P |XP` p xx ` `t | p @ @ LCR  ` \ Z0\ ^ @T40 0 cZ0S S@KPZ 0S3 0S0 S. S@  D  S H R4 QX 0Q ^ Q00Q  0h @jT3pWPp@VhX D\ l P0Lp q D0PS 0Q l0xDX Dl0^ A0t| 0S \p ` d0 p tp xp |  ` &0S S $\Y0Y 0S! @pHp  @`p0H0  @0      Hp p  @  010S S $\ Y0# ^@p` pp000S S $\ Y0PTpp Vpp0 Y0LpP@%PD0@l  P0圀 JZ0#,!R(Z&:(d 刐pd@ Hp  pP` \ X T@ @D@B\ @lll^@  U  bZ R RHpT@ P$` 9Y` $T06 \/Yo@@h@X $T dY'@  "`0 0 \# Y ``0 S ^@ T0|00j\  X0b\ X0Z\ X0 Q ^ @T0C\ X0;XP!`X0Pl LD0P 9PR 0Ѷdd#eO-P Mğ@L K |0 帄K@P b8 K0P8P >E-MP` p@0 P  Q}P Ѝ  tP  0P@PO- |Mp x t  |0 <@K0p0<0 80 PP  ( K}P K( KFP#`P` $KἔKD 8`Na@K?K>K=KKH  PMpp 夂0PpK , 00  0"}p Ϭ0\ P BP1PX810XS20 S 400S|| R|\ (0XT00" 0I  M 0 RQ0@P/ (\*  d Q0h0  ڐ0@M@`@ \ P $0K!0D0@  hKOP/ X 40S $K1"D@ 0 ?  P 00x M$K0D0x0@0PXo D '4gP00S0 T$&X"hep-QR `P@  `P@pQ R  p/@- QM`Ppp@ E(0,  0PЍA-@`MP烦`Pp `PD,(  0` ЍO-(DDM0S D$P$<0 P @ @`v0  01P'  @ p0p<@P^; 0S P E@0S:?C:0UU: DЍP $0p@[ (0S s 8 0 t pv p<@0P@ (0S,004 p Rt!<PP, , 40QY #  O0S 4 \Q <0^;Pt P ;0<0 [ y P{;< p P E@0S:?C:0UU yX `-pPj T GDDu @0嘭< PP T$XteeeheO- lM@l0 pP&(0KT`Y C 0Md  ` K K GOp0gt tPPK@ X x@ v l`d 0PPUPp@hp p`dl P0Kppp\ / LzD Z% 䥟 0w pv p(0\5 p P E@0S:?C:0UU KD Htp @ 0n 0 0S)" 0ɤ @p( pH Q@ D00P@!\P PUh \0Spx0\^0<x 0r \|0 N|0@p\\  \NQ  0 P \ Q  0 pp ` \pP`Q ` 0`pp Ph 0 S ^:U_  dNH  QP D0^S@\F 0SZ  8 0 ^Z0 (\ &A\\ 4 8 \ M @\@  @0@ , 8K|0 S\|0Pw 1PZ1^Z0 S Y M0`0  `{JX wJd  PL!0q P  MM@(0 XP@TX@  z p P E@0S:?C:0UU z `OU 0( R U_e0T8X,@-$M@p`P 0  A8 <0`P `$Ѝ@-M`P@pA( ,0P@ ЍE-M@P0 0olp0 ЍF R W}⩖? `pppp ,@0  ^W }?Ϡ @L" @lp0 DMbG-阀嘐p`P@ p P @TPd00S S 00P,O-HR M0S`Y$ Q0S@> SOT8p MP P pI$Kh Ln P  `吡a 4KL9 p0 S+ KH壢0sS p@p 00ꔢ  R卢0S00 @ sy 0 \ VX40 | 0( , <K<@ KkP,(c00cƕ e|`A- Q@`P@0A0 P@PlP`p p0-  R S p"@0  O-MP@xp`s{ 0V: P̢ p*8 媢 x0SP V: FP0 V :^  V: 0V*0W Z Y  {pVx:psu Vr:PoJ ^i^ V: EP0V :U\  V: 0VK*PWG Y 0BpV?:pu< V9:P60JSi Q R0V: EP0 V :^ V: 0V *P[ u V:PJV Ѝ 0@-S@@)7 .0leeeO- M@p ?dSP`+ 0 M 7 PPp|@h`K0<@ @, K4 0 8 LK00 PtZ,s p 0p`h X\h^Y0SV PF ph0"KQPH6pPC 0  `  埠`$ V p P E@0S:?C:0UU  Kp0!/KT/KKϠYX0%*"Kp X p KP*KhR(0 , } O-PMu`p2 @0S:?C:0 0 0S;Pu U+ 0 P P#00P p  @0S:?C:0TЍЁlTK/ 0SR*  pP 000S:?C:0 0 P 0S:?C:0 0 \ 0S:?C:0 0 ^ 0S:?C:0 0 0S 0S:?C:0 0 QP O-a$p@P kp00S SPMU0 ES ` R 0S` 10`S`V$K! M I@0 S j  vkp P Р cPE@d| 00S S РV Р @0R00N,00Pt`0-S(Mg ТВrŸ@̂ R@@b @ @尲 $@ @ @ B  @ 0CS RxPRQxPxPxPxPQQQQxP`QHQxPxPxPxPxP$QxPpPxPxPxPxPxPxPxP Q000S0R  $0 0 01 TQ`1d(Ѝ/0 00S000 S 000S0 00$00S0 !0S0 !0S0 @$0S0 @$0S}000Sw000Sq000Sk<8P0 0/@-,C M0S s3CP Q  }P|32P RP@ t 3 "P ^Ÿr0 @SppS dRdBT:EGPU:<Pw,B0S R pP3 P0DP+`V( pW0V .W" `0 x1P0V R0C .R` 0 tP0S pW@1pP P<,1( R PU  P  0  Q0 Ѝ @ T  ^ 0  R:`0{ c1sW`0pl9<gPLgggggPefggg8Qtdgp-Vo0 0C`b  P! Q$ LP @ T  B@at L PAPU@@d T*@@d T*p/ aQ*O-@MP 0 ᔅ0S `ㄥp PU 1T :!T*@ P  PU0pSL`@l1 0Q2 840LH P _ xYA ㈱!R 5 `2 \`V# ``V p``T:\ \T `T*P  W ` V0 0 Y @QPT R{ `@0` @ 0`#R HЍ00 S0R* 0 `#"B,bP` 0S*V  L\Z0S*  L\"0  L\P `V:  T:V7 T` T*R \*\ P `VP T:V T ` T*R \*`V @  P `V`VP \8 ``T:\5T  T*R \*` V Py 0\ 00To:\T 0Tf* \ _0S[ Pb \P1 0000,T8@-D0@T8nPnU @ @8nPnUP-0SY-S@-M0  ۍ @P@T 0SЍ1^-M0 P P0Ѝ^-M0 P P0Ѝ^@-P00hDh@-@M  > 喃Ѝ@-` M@1   { Ѝh-M,P \ Ѝ_DD D00@-@PM 0 @Ѝ0(p@-rM c @P0@ 0 N0 S0@0C Q 00 B0C ^.S \ @hPPrߍp\lҌ bO@ l`EV?V?` 0 (h@-~|0p@-S@P` 0S XX0 *HHH`@PG p@ P(` @  /xO- 00 P(M`  >@i 3/08@$$@  U00 @@h4CDhO-p$M@`L> [0p C Y p  1 HV p+ X( YT QPM P P 07/P0S $  Z*0S   A$Ѝ 10Q  07/P ^$0:\  \H0: \8H0*Y K 0N - 0IlhdhhHhG-`,p@T 0PS-U@0 - G}$P -$` 3/0/ 0/p@-P@ 5Ppp@55- M0#  P0 Ѝl0p@-SMP@ || %P PPP4Ѝp(`P \8@-@P 0AS08 PU 5/&8 R8  0尟ih4iA-4!P`@0S:?C:0S2U e<@@EpT0<@H S pWx@H pG<DpWx@Dt$x`Pl @0S:?C:0UUs54p 0O-S $P 0 S8 (< 0$pj \0 X\03/0Pa (MP73,P ppH l0? 0P!2AP 4P@$(, 0 pnooo/O-LM4<P((0x@0  $ 0T, pPp t0|SD@tp00XDpp  + `@$@@ $@$$<P8n8 0<`@  U :W: R6 B P 48#8 , 8<80@U00pQa `V pp@P  0 <@ T@i @@@T8 $P`  8 < `@00U7:W9:Q6A \!Ġ 8#!, 8"Ġ8<008<0 @U T T |TQP: @ 0bSU +@0U0P @0U0@```0U``0 b@0@ LЍ0P V,@6# R8, 0\  @Tz @Ts 8<0 0P 4 ,6,\4 (P1   8 c U:W 3 5:<` @0U  S R=@<0$ ;Hl2$S 51u* 0Sl@c0 "2ۍl8 l0@0Vc 0B0+@h\h0 h lt0 0@ $0P@ AP@c`@P10Rz`@?`|L0 @4 P$p pS pl: R@ V$p `cQPB  iP PBQ Q Y @V 23:p0@T<@f0?@\0@#@`U#xppp0pHx | (,0@4/0 @0 $ PP.1 $pP S U S 0B 03pLl!L1d8..81Q  Q  Q   VP QR \@ \  pL2ǰ p6B\U8\ 4^ pPLV@P \ T $pP $pPp p(p/`r\d PP ( 0*U 00pT8:Z p@ X:0`XfQ Z 0X p:`XfQ|0 p| gx00@@@D`@Y@ 1@@ @$(D 0MP@ PP - Ѝp^ S000``@P  s"HH xPP<@@ u 0yxH uu(uttHuf 0 13S* 1S  1,10S  1//0 13S* 1S  1,10S  1// - p 0XE0 ,l RC/ `1/b//@00- @@P 0 0  0:0/o8 @ :0  Q@-@01A/ⴌP01qP0@-00GM@@Pڐ0o0  Gߍ0F_% DX0 F/  1   tPC0/Ԙ0/Ԙ<0 r/R P AԘ0c-A`d P` @1  PP3#0 0@p030#@3@#0@`P p3#0 p3p#0\0/0R0-"JA T PB!P 0SJ@ T T@0C T@A TPB0S Z0/O-m`1S 0d`T K 0WaPM0,0 ,PP  Q0 `dT( PVA @@D R0S B  R 0 S 0 S RS B Q 0 S  0 S  n~ 0P Pv(0 ,`M , 0 ,P 0 \#pF 0 `V`0` `V 0 ^  \0`F S V\y P \q PP\g M 8 8080  dd`L   q 0 pV p 0  sp 08G- PRpK0 Up @` 0S4  i @`1pS  i`U1pS  i`p1S 0`U 0 0 S40 ES  R 0S 0S USR0C0 Q  R0  R 001O-$MPH` @CT0`a  1ni 1gi$Ѝ@!0pT  0 0`  P 0  P 0 0T. 0T D0\  P p\p p\   0!0 :0 S 0p p`T  0  0$p"  pQqD0  \ 0 R \ B0S00 T0D Q  0 R Q0 Q0   0 PB  0R0<H0  R  0/X-  P'H0S00 r  P2 0Ep  pP2   06T5 p 0p3L  0^pTH-QM SڃMK.S !0M 00cp-A`d P` @1 P c R0 0@`030#P0@`P 00c3#S \00p/- b@$x#h  h" X)h Pe@ U P L R ` "#x   x" X)x P3#Pe UP1 P "#x   x" h)x 3#`ipVp `,h#   " )`3#aQ@ /p-@j!ʠ QoF`Fƌ@`T \?o S C cA4LT@cp/\ oo 0Fà `c4ƌCc@?A0-_ A:FZ @% 6cV0/O-QIM`Hqp QAm P⒑)0b  $0 0 iX  P6/P3 6/P @ 6/P @ 6/PX*0 K[   R   0[ 0  [ UP UP @X 0iR:PhR %11% % % %P U:Iߍ !"  0 P S1Z !@%.: 6/ kP@ Q P T P0K SP  R 0 S  PP0 S@kPE D P `Y:`p` 7/P0`V P pPpEY X P 1 :  0d VpGYPHJ P g  @0iRg* h\@%j*Sn 0@ 0a 0@K[  R 0[  0@[@  6/P0K[ 00 R @[@0  0@[@0 K[  R   0[   0@[@ A@ @-` @0S:?C:0S)P0P P @0S:?C:0UUP 8  .dt0 p`(A-`PM 0SJ =@PF4q P0S:?C:0S<X @T  P=\ @TP @0S:?C:0UUct0 p0@@T(c  (dO- M`, ( 00 /( R4 P ((4 t @0S:?C:0S<Xp @Tp p P0=S @pTX T@PV ,\  Q ! p@@Ph#@0S:?C:0UUt K40 0 M  8  (4  " Q80P Q80 w80P *  G "O0,PL"@0S:?C:0UUӸct0 p HgQ cP @@P!@0S:?C:0UUbt0 p0b0 p0 Rk ,PP Pe4@p0 M c  ` (4 ]  w @P PU PP   ѕ РP` @0S:?C:0UUڝbt0 p Р3(H@ Pp@-@P`P 0S =j P0p@zb  p0S /P@-@ S pp TP`% T T UPPf@UPP%Rf %Rf 0Q0f  0Q0f,%1!PEPSfd:@:-@M`@ǟT7 0[ [g Qhǟ  A44  $  R0,Q 0!h*Ƞx  pȌ"X'Ȭ<3  lS` Z0 PR0` 0 SP0PEP R Q[ !h*8xp8"X'8PcL03<  lS` Z$ P000`@Ѝ/Q#  b P DPB@ ` VB`LP`L H`L@`L Z`LP`L L`L@PLPLL@@L B L B!B  B!B Q6 a P CPB@ `TB`LP`L F`L@`LW`LP`L I`L@`LZ`LP`L L`L@`L]`LP`L@`LAPPL  BbBB  pQ:\$ @Pl0e pe U1Q$ l((p0X `g, $*h(Xx pX"'X$PP%x)h X `"&(p,` PW1eQ$`PQ X  pUX PP PW Q`%i `"`% P!h%x  p"X'l$`*h)xp"X'$p`WP VP PX Q"i \`(p : p X'hx`"&p *h)xp"X'p `XPU1 `PPU pVP Pi 0"48<h  Pl0 p\lAQ`*X(hx`"& h)xp"X'`VPU pXPU WP Qi 1"48,@:d:\70@-M@Q0 Q 0R 0P U  0\ `@Ѝ00@-,M8@( (Q0 Q 0R 0(P U  0\( `@,Ѝ0-HMhPGUǟS S|  AȷQ(pD@(p$@P<($`@`<q `p pW(0>Q $ !x$X  X"h(X5Y faU` (PQA $p `RPUp! W PU!PU!! ``P pEW QZ $  I!x$X  X"h(X`eP5Y faU` (PQHЍ/Q$ 0 bQ D0P@a V0B`Pa0C H`@a0C Z`Pa0C L`@Q0CP A0C@ B0!! 0!! Q7 0aQ C0P@aT0B`Pa0C F`@a0CW`Pa0C I`@a0CZ`Pa0C L`@a0C]`Pa0C@`AQP ?1(B,B,00! 0!  @ Q:T,@ @Pd0u `e U1Q, d0x Phe$4``0 `,p'&Xh  X" x*X,PP%h)x X p"'0p4` PW1eQ,`PQ X  pUX p PQp Q`%i `"`% P!h%x  p"X'd,`*h)xp"X',p`WP VP PX Q"i T`0p: p X'hx`"&p *h)xp"X'p `XPU1 `PPU pVP Pi 0d"<@`DPT z Pd0e TAQ$p*X!hx`"& h)xp"X'p`WPU VPU XP  Qi 1"<@P:;7-0Q  QU6 pW `   Q- Q@ \ \ QQ cR U W` @Q P UY 0ᾐ/@-0Q  QU7 pW `   Q. Q@ \ Q QQ cB!V U W` @Q P UY 0ᾐ/@0A-S`R SPNTL@TqAPT 0S:?C:0SNDA^;  fBPuPP: 0  !  0`QP @0S:?C:0UU]t0 pl0]0 ` P`\,` ``-L--M0 0YЍ Ѝ/--M0 0BЍ Ѝ/0 \0A- P @`aFa\ S \P45* S0 Knh0t` pP IH`[0@K Sd  0S:?C:0SHKd ` 00 K` `hFa0 3/V+ `0 Hp0LS00P @0S:?C:0UUD[ 0p*KhP tKvJK`@Q AKAK. Kq  p K LZX4 xؕ !K,@0 d0嘀 ܀ pȀ唀 ؀ 尀开 ̀ 倀0 CZRx !<"Kp K p0 KJK\@A T   r v1fP`\0Sp   R*q  v K `R T   Q v1@fP`K0S %FV@iN0  3/X:1f X6`P3 KK⠀ sKJKx0P@C T    v fP`K 40"\0R# K$Sc  P_*q v `:K^ T    vY@fP`JK4V K:K 4@$$0aN!3/ lAPf P:K ` K⠠*K K\*K4@0JK 0$AK@ $AtJK# l #àxt#|  l@ K@ @JKx@ Kl@ t@JKK@@ |@ @! t @ à! x @ @  $A K\x0s KJK1t0S0 0t00JKt0x S0S A T0 M@KA *K Rq Ɵ0Sm K!P| g ,0  M S{*$ K !!0 K:K4,\*K$ @ApTK 0z03K SR00S  Kt04@ sL JKt A T MK@l 4Kd0K` d dp *Kx0 S2 J:KQ\ K  *K vL1fP`V K0 3/ P Kp1fZl`P \  㿽 v)!f P\`:KlQ 0 CZR K Kp$!\0S @T%34@5*v< `LK0S pp K| r0BKA L#K :Kpp Kd R [ B=KC@V :K̀pQX *K0 KD K*K─0jH1<  Kd R K<0S \ 0 pQ000*jKd KH @h 0KRd0@< Rd0Q@c p\@D:K K| K0 K  0@D R0 K| R$ \0S P-345*v `KP *Kp0SU *Kd0 R 0 vH@fP`V  ` xq 00J0 C R0 0 C Rz Z: @A T M @ K$S㘠U CZRx q Y0*S8 0 C R Kd$ 0B 00C Q:Kd R  0KKd Q  R s A T  M0@0 CZR x ҕ'!L! 0 K CZR x ҕ!p (!pK@T4 :KMMJK, JKr㜠9 JK`Z K p` p`` P 0l0@ K  ,0Kep\ K  Kl^ @4P:Kl 4P0@M@ R*KlK Kl0l   @p\0S @Q * % v `HKpPK*K0Q@C T   vV fP`\0pS  R *q  v *K0`S :KJK@4J*, M0 K!Qtx 3 K@A$l@ @x *Kl@0 SJKl  !*JKlP Kx K@ K0t@Sl K2 x5 * K@*K 0 S! :\0S  Q * % 0@ \0S @Q *# 0@ \0S  Q *' 0@@N \0SK  QG * + 0@  \0S6 Q2 *-  @0P 0 \0S Q * I @\ KK x` @`lp:K! H \Ÿ0:KJK$ l!0 ?:KPKl0z:Kl(K$ 001Klpx` q: \0S Q* . tf KKlpx@p@ ?P/A@' ?@P:Kxp@p\ R  \ *qB t@ p@*K PKlpQ \0S  P* q ) t' @ vJ0fT `K R \ RJ 0QF* S( @0(0 (0 ( SSs<`  -=SSB(K ( | 01S(@ ( @\0S  Q*0v \0S Q* K | `v `z(0 ( @K K|0[ K|K |0[*K|K|0[*K|K|0[*K|K|0[*K|K|0[ *K|K{[l|[@0{K #K K| K{[|[1!0*K:Kt*Kx :K p|K{Kx \K%K$ K "pD˟ K x!p K<"p"@K ! K|[ 0K|K|0[ K|K|0[ K|K|0[ K|K|0[ K|K|0[ K|Kl|0[ @K|K| [{[ 0#K:KtKx | K*K{Kp0 x0 \K%K$ K "pSbK) KPS *K$@`V \0S  Q*  0@<  K$0PK l僡T kK*KQ0l0i Rb:Kl T p Y l 张T  PSo(0 K |0( Rr. K0 *"pK =*K ' 1=:KP K00  K0D0 | K0 窡":K 0-;pZK *KⰠ0l0T p00C1Si K*K0ǟ0Ml(K1 CP  "0up  0tЍ0,(P0&"N\@P̎U8pP C-@ MIPH`C0@S  0S:?C:0SaH`  0\0#$ lP' H`00CS00P @0S:?C:0UU 0YX  QP0 Ѝ,$ lXŸ1sC K0mC 0pcC0\   |` H`P0ES00P @0S:?C:0UU:Ct 0p?O-PQ M` P 0IHp C@Q  0S:?C:0SHp0 EX 0 Rx6P\ pphWO.p'  ph ^P php @tQ0 S S! P7 0 Ypp 0 H`0@S00P @0S:?C:0UUE Ѝp @ph000B0  BK0` H`P0ES00P @0S:?C:0UUhB븤 0pM>^Bt 0p{CtTpC-M P@U$`-V l0S \ Q U S1 ` 0$1/ 0Ѝp$P U  S0`Xß0 0B 0_댍M-@MIPH`B0@S  0S:?C:0S7H` (,` 0`` Hp0NS00P @0S:?C:0UUЍA4 p0zp H`P0ES00P @0S:?C:0UUڝA븤 0p=A-M@Pp`0 P@@司 0 O 0CCЍ*$04 R/($0S//$0(/A-<M4p$`(p8P,PPp@ 'ᖥ00  0(5/0<0( P 0ЍtSp@-P`T X0hPM@t0 0 0T5/(0T P0 ЍptSA-hM4pP`Tp8PXPPp@ 'P00  0T5/0<0T P0@ЍtSM-M< q`MP$`,(PPK (@p!0$ K 000( 05/ gKQA-PMp@@@p$l0SpW@GTD\` K0> 0p>0\   x` H`P0ES00P @0S:?C:0UUھ>t 0p:Ȁp@-P@@p ᆵV 1@pp@-P`l0S0l0@ 0 3/Ppps p00@-S M@ PPcP%Q;!B  "0op !0j Ѝ0K0@-֢P00Tܘ@-@MP XwPЍ 0< P 0S 0S"T@-@0S @,0@-S$@@P|1@-S MpP`3 @T P 0S 0 P+0 R Ѝx@T d@P@P@@ D^ P @-0MP 0AZ 1SO @PK P PU PP  ЍQ P U P1`V ``LG 0 p  PP  `pPW pp.GP 0hP 0@RQ?  T4|7dT 0S S 00 0-M 0 *PЍ`@-@0 @ R(<P" 0 x0/ 00 0 @ @ @ <25T-M4 0P}Ѝ00@-SM@TPTTPP@  @6 Ѝ0 05/(UP00- 8P @ \T0/0p S@-@TM>*0 !< `PU8 `V` V ڠ6/@TЍ`0`L@4`pH @pLD  00(`,p$p<`张D0@`0D 4/PP P @H@VP >PwC0S/S/S/0S/-xß`tCVƏ0C8hMd Z l ,ȠP 0C \  P0C*Z P0C"P @b @␶P& 0 Q @ JP0*J@ DP0ʜ"ᎠkB T|ha¯`Fj_ Ahde XbaQKP0"0dS(BB`P`nRHRF SGPE`R@q @krAOPdLBQP嚱gcdIq 0$Opk0`?i`Cų@d gO@k Rg 'Q l00CAK1i!pg੟O 0e?C SvB K U0d@a R  aR t Q BQ 0 a  Ѝ/E.€QQų$IQmn$UE-@8/PPUpU0`gS` U`e`` 8/Pp`PU0`gS` W P Rp 8/O-0@ ïɀj P C`?M`cUpP4  , p  .ᖂd"g V  p 1 h,p廀40AW  0,;\;Fvp.UpGF0F⃁ϠlQ! w?B CPh_L E0 e 0A%P Rl#0H0a ! KW I:A cP`P堀(h0 h 0PP  -NQv?00CnÿPkPePc  PlN 0LQK n 偰 0bP en !P2beP/0U "R S 嘰P Q \ Ru\^\ h $P0(P P+Ev?00Ce!nP lPePc?B PCN P 0b nP 0enP "leP 00U!Qq S [  U \ P+ \ ^\ h $P0(PX Px*Ev?00CeP!nPePc Pl?B PCE P 0l eQe 0lP "leP 00U.^% S= [  U \ P \ ^\ h $P0S(P  P()Ev?00Ce!nPPe Pcl_B 0E!C P  l0eQ n2eRa nP00U.^ S [  U \h P \ ^_\ h $P0(P P'Ev?00Ce!nPPe Pcl_B 0E!C P  l0eQ n2eRa nP00U.^ S [  U \ P; \ ^ \ h $P0(P P&Ev?00CeP!nePc PnB 0PN!C0 Pl cQ2e lRa lP0Ϡ0U,\AUu<[0S 0S ^SQPЍPUu10E9:PUu10E‡ʈPUu10EPUu10E PUu10Ekl0ES Ϡ P\ P0`P p R XnV fS R jn f R < \0S 0 R < \ R 0X  EPNav/  Lp P`n?XQcab  1`aE0P`A!ED n Pl0@`! fb<` 1k Po0R`&VRr10B h 0P(P0h0(,k4` Pl`5`(`PU U0X$\Q$\Q"$\Q U0Z1Z$ S R U01 U01 U0C1C U01(0$\QIʨ < M\P^ 0 R 8 < A\QR 0/ BcQaQP`0 pW0<S00,k`php :/,Ϡ/UPP"V,0P0SPs(e(bP(0_ R10Tꫪ*Q$Up, @-@' @*객 @-p pက0 `0S7 bzp p p/1xH-`H0M I PT@ P^ @Qp0  @RA PC\Kx0S@P@-0hM p pP hЍ jp p0< 7 0c0 ` 64a a@- 4pX p0က c6 0 `@-@`0PS@p p0@Wp 0 p @ &p4 6 c@6b @ (``PO- 60 0 0p@8p` PHP@`尐ḠẀp`Q$(`0d$(4Dp` P0@LP,0T0004X00\_P@- D1s6 0@0@F0`pUT @*BpBCp```UT2,@D8`UT04@HL8<PT@D\XHLT0P0P0560K  0/64K0 0'60K  0^^]]O-RMM@ 3Qc Qc 3Q Qc #Q `PP Fp  ;Po T lPV p P Z  Pl+s_Pˍ QPtDpT ,`P rR0oS Pp@TЍۍlPp XPp DPp 0Pp P@p P{ P{ @Pz@T@V00S T sO@{VN `Q|af )tqQla` h Q`a[ \ QVPaUpDLPPSp,QQ(aG qQaA  Q<a;!Q`6 PQ`1 `Q,`+`(Р`%`Q ` 0J=렟xUJFS1USpUUUVVVV$VhUiiU`UDMUUNTFSUBSFXUreebUUsUIUUXU`UsIeRU0VHVxV(8@-P\ @  PPP$$ PD048<@, (8@-Kp p0က c4 0 X@- -p p0 RT00က@04 0(4c0 0WWO-`R Mp@P+ r 0PP1 e\0*40(0 e eR:0!P eQ:0VP U, RM ,  ^P( QV>(p W1 `(0PF pSP 1  V-U P WP1 LpW  V W1 ; pW   V PWP1 +pWP,( K=mPEP0, ,0 ( @,/ WA-@P0`S@p p0pW 3 cp 3 0STP A<\m 0 pp,m3gpTT 2 2 2WVG-@MI`PpH10@ S  0S:?C:0SH  @ jP  P 0 S SS#S S@ S S 0SH30 C P P T 0 S SP S@ Sk Si 0S@Tg 0 S SP^ S@ S[ SY 0S@T? 0 S SP6 SP SD SB 0SPU (  0P! P!  H`00CS00P @0S:?C:0UUCۍ 1 000_T00    H`0LS00P @0S:?C:0UU 0t 0p Qi0t 0pVP@- [xH-P`q 0M  (  @P090Kxp p p/14tp p/1,( <Hp p p/1 @-Ti pp 'i@ p/1)0 0-0p p0/18 < 0-0Pp p0 p/1@-(i$pp h@0 p/1"O-P$MP Q 4B0Ss d R0p Ris $Ѝs/ aQ4ZA q@!8` 0   d0s"` V@7 y ^"PU U\ d  R0p  Rs ,/  R  0!Yp` V@0/ 0 d0p  L /  R  00H ,0(7 BWWVA|A8AWWW@-@PPp 0!1Q p p01U!R p pU\ p p01UPᰀ$ !ᰀ@-} p@-0P@`Sp0 S S H P( 4 P-  }P.  wP  qP* 0S S0 SS SSp kOd1P000d1 `OP YOP004 @P   :P0'  ,P,  &P090  P090  P060 x P050 X P060WWWWXX$X0X8XHXPXhXO-jM !Q0MP1. d`0~` sϠd1G``0! 5̠ ` ` `a`aaaaaa evpP - `@ `0_aSD@H 0 \P `t S ` R* S S S00 Q@0S D D廊P \@`H$@ I (  P 8 P;U#U  fP4 \ \/^P U U U UPP  `0_QS S S S   S S S 0S  S 0 SS S  +Pl  R RgPUP U U U UPP r_Q PP`0SD   $P* $Qf* S S00 P 0S0  0UPs  lPe!űd 0  de! P,`0S% hQ`0D0HouP H&) 00DЍڍ $ P ` ^ ^ R  Pp X X [) X X X X ;X P`U;U ,  R 0  PU Dj0P 8 fP? ʍ -8pqTP P0;SS` `d崄],   `0;SS R $ ,  G,Xğ  fPd Z‡8 [jp0 S S SS  %P00PP000S z(p  gPL`P 5  UPP0P az  PtP U Uo "Ik'<\ |40S"J₡0W 逡*\ , !Ă 40S9J ⌡0J\R+P |L2+0 w82^4pp (@YP.P `S b c0 SS S1^4 R00 0 GZ8ePW 08R 5̠0  $,  0ʍ( 0S (Q P <zL < PUPPH)0\PWwP=he`FVV `/P5[PU3PU0 P  dPX pW  pW Q ^ XPP CpPqЍ/`xtlbhr `< L @@8 ?B  0 S0P`0a S0!03/P { 0 VP! 0 0 0封`RPU}딡`H[ Pv4VX0S 4   "d  , @0 !T[<\hZQtdRtd@bQso0 PP/(0S0 (S%S sS  20$K 2 L" P L"P2r P"P0`P{ <" 0W*0 cW*P cW*ccW::@ 0&@K%0KqxSM xS@ 0 0@"L D 8"Lr@ @8"0`RD28  `0Q b` D R D2D  A8`Q D8"0R@@AA$K2 P*Q 0s$0K " bP$KA`b "PI@ 0`$K2 P}@4b 000 x 0 k 0ggggg--M 0 Ѝ Ѝ/-00- M 0  ЍЍ/ -00- M 0  ЍЍ/ p@-PpM`5@PP  %5P8QP5pЍp  0}<PO-SM0S  iiY#R0 @3Π` Rxs`=(S?* 僀 0 4#@0S:?C:00@ T 0 (ሀA+ᰰᴰ@"0S:?C:0S$ 0Q0`Vu@@``  @ 0S:?C:00 \`(0VV*p p 弁 @ 0S:?C:00@ T@ 0 xpp`1@@1 ,!@0S:?C:0Ta P @ @ @ 0S:?C:00 0P0Ѝ `!` ^ 0S  0S ` Q P  $` S4PTO- MV? P1"S*ǟp`P@V@e 0S*Q Q 0S*X  0Q` p`Jp  0P!\1S:` P6 p`@F2 1SX  @(0宠g2  ( \ `  8K㪐X` TP P 4 0 , ( %dvd&s090KP:K@ 弃KXKDvL ``] PMPO/``KI%3p`3  K3P  ^F E p+4K. 0 Kv pJ`P! \ 1jS/0v\ ` (pE @p EJ `pJ  P !\3>C `pHO\2 K 0\" E \ ?QP 3 0hPh\d`\ 0:p,D 3`8)K`d $`8KF  ねP ^  xPPB X \:P`<ßd 0Ml D#\ a L$lp ,h 2\ B  3p 0\ BdB   t2P$ P`b T2P $P( \5 Q ŸN 0 P %aA` pHP0Pp(PQp0尀 B` C3 V (ap`pp(PUp尀BC \  )10x``'᳠`傁ഠ᳐0&`pp) pAⶐსPU紐q綀@A\`XPfZ8# * }P0#*P u0d  #U*! 1!1gd0ꃑ` ` 0@\ c\9\<Q4gTgBhH@h@hthx$hh 00/((@-0`@!.CTP1 !`4  $0$ 0E0hhhhOi@-0S0   ` `P@ p R xx] t0\  @PbU*Q PU P4(O $0 P4 $0@ihii<2@-S  dQpS*4@ d@\*Q*00A-PpC0`V@ * `Rq 0VP:zX K>blAo(O-P MV 1 PpP3U;* RE: ap`pSA,(^B: < $("(2,” cnPQ`Pp!:@T 8X1P<2<"1PQ 0P*[LLL L0[ Ѝ8(4 (0R,( 0M 0ihidi|iA-@K^ 0```PP@ `h@P  DHppPp @֜(( p@-@P 80PЙPP@Pp@Q@ @-MM *UpP00 p0SP#  0[S /S[UN E@/T 0@PB @UPE/T=P@P= U@  E :006aP1 PԜ@P+  *0 c S *p/Q p/^P /\@S :U0@/QPE U/\PE CPP@Ѝڍ( v0 0jHTj,jTjp@-@RTU5p`PU 01S @ p|03/0S C0SphP p03/pd0d 0@-S@Da ]7 P,0 P<QO-  l 0 0y L** [0  0 0i `P L l0뢣0  MPp8,p ,ܺT4jdjjklnj`!A-RP` \B@1` 0S*P A`0S *A0唁`0S`:(2L@4$ XFPp  ` `0Px `@!`!0R* \BI R ^ G R0R0_L 00X*`њ눀pP&  !᢮ p 4S!m`!0`y00^Pp  01/ 0T kO- ,M$, ;( P0 薟覟0@S`LPp U V :!V*@fP  PUPpULLP`V@MPu  `V0pW(0p,B 0Pp (\A0T1( P 0P`!R \1pQ| @RP P\( @ST@P@@ 0S0 T @0 UT`!R9 @W_0,X@R#\a甡 XP? P4P2  P!R p_L`!@R PY 4P  01%(  (3 —‡@ KP (`!~TP@PPCRP Pu ,/DP0@5 (   .3 ß@  (0  !-& Q J/2f  2a nQ,  R ,0  0 80 _80P   80 4 +,04S 80 800f 1lT,rP0H`P TK P= pD dpPp!GP%PMP, 0bP,P P X1@T, (1 1  >S80 !80 Y'80 8/!80`!0^  @r@q\ X0 |Hx D0 <–\ 8 X0TLPkklkLkhlxlk,K# !`, R qW[(0(0 ,b Z( #K``P \ I,  a, qR Qm(( Zq,K `, ܡ R qW(0(0 "K^$b  `J`!~ ^(0 ( pp`IVڈ FS@4p05*`FVW p W@4p5q *`FV T@2@5_ * ^4`Fp5P *`FV@$0p0X@W:$4^!q0B11p 0p m\BM   Y 2 t  S145 *a81nS$!YIRBM0 `a 0Y Q1@45*Ё8f\1YISa  YW  R1@45F*`8iQ gh갑  6ā 弁.0!  SZ qZQ P}   ZJ̡!  a`N Q !P1 p7ā 少 弁崑jp@g`01 @ἡ 0ᰑQQ0L11 0 qW0@11 0 42 0" 42P ! aV0@11 0 P  R,30MQ! g ᷚc\q p p@Ws1p0" 8 娋0"8P @!0q ?Ш a `!R `M!0 0+P!a0B11 ! 0 Dic`ԡPp ` P~(0 ( pp0 8 4b Hj0428p@)?0 Ma0` 0Q!a0B110 00 uZN((  ^d:0ԡ꼡 少 0 L!R(  ( ! \aV(( ^5Z( ( ! ^^!q0B11p 0p stā 少 弁崑 Hg10SA 1!1 0 q0 f0"HRWt Vq! ` 1 `B!Q NJP1 p1 a HfZa! a m10SaqAq100 BM! l 喙a 8,~   + \ @p P`PVV*`N pM0 06  10S؁a1H!10 y0 8 Ji08p@ 10SL 1 00 1 a 4ip@@ 14 ]10SL1 1 0 1a:q `a 0J`1 S qM1 a Wa !!`QWZip@q 001 lhp@n`T`.ꊐ Y3 `MX `  <ꊐ Y3MX `  Lϟ! 10Sءq1J 0 ^BM0 `  0at  0\ 01@405*pYp0a p`a 1 Ia hp@tT` ``10SءJ! ! 0 M0  0 1 pIꊐ Y3 MX `  ၘTP1a C!!0 0 10Sq1G0 oM0 0A10S!B 0 %10S!B a1a 00 =,6 pq M0 0_10SN11 0 C10SءJ 1 00 da`a0 8 h08p@ 42 g42p@`|1 p01 a Rgp@[ā 少 缁崑 8 g8p z42 g42p o  Xgp [gp@8;001 $;0! BM! l ŗa bgp@` PYIPABM! Თ @,! Y`N @Q145}*q80pn\B!YIR`BM! ᕗ ` Yp1 P\ 145[*q8 p1iS%YIQ@BM! l @va Yp P\ 1459*ap80tP!YIR`BM! [ ` Yp  ^@45*q80pyPXa BM! l >a !p#gp@gpgpgp}42 8 g428p@H1 p 0 fp@ ! ?fp@\'  W42 f42p@1 '  a a  ^ 1`z`3 a F"P tT @Q1@45C*.Y"\pK 0jK`0 0\0 X0 6p` $K  N Pɉp3 `Vr !jK3`b a ` V`,,"P   p? $K, 0!C` V aq1S Q!\ jK㴡  a Y !0 `@P0S T1 \45%*@D徊P0a Z`T VP 嬊PjK E0!K(fp' 0@Z*t HKc@@DZ*Dc0F Jc@ `c \ q t H/c @(001 0SaY P<Z) 10 Y t 0S@405*YIfep@ßa q ! pa q a`a q p W|3 MV 0  4 ƕ42`0p03 ^\b 0`A  RR Z@> 0 ᴡa@-T+T!Z  @ Z !08QZ   p W|3 0MV 0  4 x42`p W|3 MV 0  4 g42`Oep@Ex!I  @8 Ce8p@ _w$9ep@4  q j,ep@H 9&ep@9` `p q >ep@D @Tep@  ! 0"42P* 1`@?>l==<4<<899885h4D4P211 0cp@&80 Rđ!Y Rrq q q0@`Zh Y1It `\ 0 S@405K*fcp@d 0 R0 aY V6 1 S ʼAA 0 @ Y !ӊ`ᴑ q ZK 0 0^V X*  S@405 *`H T 0 ᴑ 0 b0p@0h ` 崑 R`YJ 帑`Y p#q %=*t H_ `F\*H_ Y !,30MQ! 0 4 噒42  ᴑ`0 @g @ 0 sb0pp@1p@4hbp@) đ@.`)]bp@ Wbp@ cQbp@`*K  ?Ebp@ ꐪT`= ``yQP !1  p+bp@ m%bp@uk`p! q !   ! (PG q pbp@ 10S1@1!0 pK+ T`.ap@ ap@0042 a42p@ 10Sء!J1 !0 z42 a42p {q K0 Laa `aph <T`8 a8p O8 a8p (0 8 a08p u F ap@X=0 븤 0pzap@mt` }np! iap@cpq  @d Sp!|3@MQ @ 42 a42 0A`1 \ P a q 80 D`-!Kp `a "0` !  A  Kt@@0T KT0 P0 K⠓pp0  X- ap@T  ? d0M Ꮝ K⌍j/Kq崁Ђ`0@(V1 A A6`Ab 142 8 `428p@ p@ p8 `8p@ n`p@Ÿ 01 20a` ^3 p!MR p  ᾐq 0 42 `042p5 @ R .PŸ  42 `42p@ B0 8 `08pw @0 @0 v`p@ 7`允P  jq  qapq `A T`p@N`p I`p@ Z0J0`XP! 0G`NP 0<" 0` A  R Z@ 0A`! - Sp!|3@MQ @ 42 42 8  0A-@MIPH`0}@S  0S:?C:0S5H`p  0兣00 0H`0AS00P @0S:?C:0UUЍt 0p` H`P0ES00P @0S:?C:0UUڏD 0pt-M0  iPJЍ|60@-<=1SM@`P``PPP  @_Ѝ0, ( 0 (o|7@- 1P@7@P0@-SM <8 !P,@ @P Ѝ,7@-@ @-MPP0  <800P@@S Ѝ,@8@-@ 0 8@-@PT R 0S P 80R S8p p p/1$JL0\ 0-PbOA$(( R 05 11210/dA-@PM`P< 8q Q  &PЍ   P `  @`P0  CQA  vP$0t DP P  P 0 0 @Rd9@Bt0/p@-P!A`@ 0T1 Q @Q `@QQPfEpO- dMd d@&qM@@dR ``h0 l@ 0T 6   唁`B@p 0R1$0#^ 0 1R@` 㔡00  0Qp@ 㔁   a@P P RQ0 0 T X Xp@o0<04`\@ ,0 @0p@ \\p \ \_ $0S 4 Ph D @ 0< SHp y \`P` S@$@ PH@K,K8 0K% Kl>@,Q540`F Z1`0SZ P!01y@P a  p䟍  ᚍ_LA\@pW 00S7 R\0 \\p \ \1d`@W@S@T \ 0S A J РXM  0T@@ T X `V|Py`A\0 @0t03pQ00S&dp` P d@T `  T0ay@PS Tl qdh`0\q^\0q` Rl +  d\P \d qW S"pS!@   P pS @  q @ S@ pqPq RT N PX0 PP0SBA1` `x`P T ̌d0!Q '!`  @ 0Q\ ` @0`@ Q` 0QP X0 @SdPS\ P` \ SQ ` Q `QS`PQ\ |0 TP o|0X P X\ QRp` ``!RpS0@P U  QpY `@ 0 ST _L`P0QA \0S Kf !|0 x Z|0xA8 0pTPP Q Qr0P p) |0 j|0Q!P N2#M 0fQ0Pǟ0> HI:P|0 |0 @rss* $@~Pn@8 tN Ɵ@8HK0K,K% K6,@TP `0M0`@Z4  4 !4 ``V`0A@ 4Q  4 ^@4 44 T@^ 4 T `X\ `0 X0  5@x x`PM x0`P M m%p[W0  ,;wT,P  5N0\@ 0~03  R{ Q`@<ğ @\ 0t03 |0 T B|0S\!R $4Rx 4MP 1\ T0 *s0 ,0u,X($X49d  4jQ `p@`qd` Vl X *\1qV 1S Q  0Y萗YZP:Y* !`d  `30`X@0\@P X@ P@T  4 \4@@ 44 P 4 *0PM Ⲋ0P@ M ⧊%p[W0  ,uvP,@ \ $@P\ 0t03D P 1u0p\ 0w032!  P! HK0K,K% K81,P %0[S  |09 @-1M@00 oЍ/O-顡᠑ a$MVB|8  04#4PI <P7 ppYRpW. @^pT1  @Q(0S X`  ^ Q aH0 $ЍP 0 ` R`6/` 00@@ P @0S:?C:0UU 0p_LqqqO-| 8P`0` 4P,ĠM 2V08 'P. PpRpW% `X}@A1 Q5Q0S X 0 S R ЍPV 0 0/P @0S:?C:0UU$ 0 p04_L0qqqG-`P@p R@ P0S9 =S  0 3/0S)` 6/IY`X 0 `3/Y pWH0 R(  W000rO-$MHP@U @T0y PuP3 1P0 @Tl  R q PT`" P U`*P0 `T` \0SQ P`T P`R0 \0DP`R\ @ @1S R UU0  R!R( R `pf !ᵂ0SA  @嫂@@@ @T$Ѝ||/ x00!S 10C U0p`j !ዂ S A  @傂 @,r8rrO-d3 $M0SJP#L**pDc@@P 8HQ0p P3 \0 0p W00@M@L0SP P 0S  RQ!1 R 0PS0U0Y\Y00S AQUlP2S @UO 4 q1B R㔑I LR1  0 0* @@!< 8 2/<80\  C P < 8 9/<8\ @ (P Pp,@ @, K P,0S P0 Qy KPPXT, K> `^}@ 1XTP, K T X0,KH LP D @0 8 弄_LT1PP0K4K% KL@K4P @P @0S:?C:0UUt 0p4@TL w0M ₃0@ w PM w%`[VP 4Eo 0 0/U !W: W_: 0T|c(t- M0 Ѝ0@-M\  @^ P ŽU@  …^@ P ŽU@  …^ ŽB $^$,  0 Ѝ0 0- 00 =L0@-@00@3  0- 00 0@-@00@O- MP8 0S0 \\Y0 R0/SQ9SO0V8  ,Z$0Vp`0V 0F R1P0 0 \[ , R(0 ST: R  Q 0S0 \0Q4@0 @ aaF^0`S`r`V0 @0pC W[ apeV``[`Vi `-Q +Q0(0(00A S\P(\  0'l=0100NX00A \(X0c0 0 QSC0\0q@D0^ TQX \- $PT R! \ p\^ P0 `V0Q4[01 0cp@b0[ Za0h S 0 c'P 嘠,z [Xʔ0`☐ 0 p(`$ Y㘰 Y I $ 0$ b@P`P@P`gPŜ0ՠ  00Ŝ R0Rh0A*qS  R S pp   0LS  H0pPp4p$0 !ȠH p,00 N00C$D0pG (0$ @ZPM  P K(, "8P0PE*PPE0`   20(,0"(S J*SJ cX &Ƞ%   "8.SA20fQd S TPE 0P@ o$0P P D0*fPE<($ ^ 0hC 0,S R 3 S  0BS[U o kQ k0= kH50D04 ?ZZ H 8IYP L04 σb0A8 0$00F SX81iS nS $P0 $ 0Ѝ[`ZX T Q( 0S0 R [eZ00S , (0e$Y T0n $08 RcX0 RT[w40 0B ^a NX0pZ0Sh 1aC Rk`0Fb`@ 8 2qxWp` (pBfZM 0 0C P0A ^``V0C0Q P@D TìH p 4`p.v`'`8"Q la @[pV[\ T, Xi T WL*0N@ X @@0PR 00J X@P 0H Z0L@ Q @0P kp0($0p(0,p$4  p @m0Sp#P}`Fp R  Q 1\@@00V``K8 `4`V`@10 p4 Xt8<DVUUU[ PbRڅrWE 4R03h@* !S Q 3S 33S AU0 @0"QS  Q 0S   0S  Qᠠ 0HP[PPP0ŧQ8 "0R0Y Lu8P00C \!aBP_S )SU 0@T @J{P 0 0C0[PDH 0{D40 040 e40 j500h S 0(0S 0  c 5@P`TT@)pTp'[{$ 0 $0ep [pPdX% 0f$(0Wt   0(xSpI*SIppc  P~ 0x'SPE*SPEpc X&(%88"!8  SdXS^ X0T PEpPp[!U= 0o kQk0[ k5 $LW^pX$ 0bA8 0{ P p: fP p{$0 0$0 2e$0 a5 0 0@0[PiV00F(PPppP('hw @ U@@* U@D Ped  U@* U@[ PeHT o kkP0 k4 LkU0A8 0PH5!{ @  0A0[@k[0 0 d k40008 0 !P={tpp$8SA єPʠ!003ꔠ⨗ ! `k0 { /I0VT00$Y $0 p>! a΂P pSP %p W p <ΌSp$9($ 9 (S$ f\ʫ0Cd0㠐ⓑ!0cS N  RGP !zB @{4 0  0(d   4XpG0pl@ !z0l S!0 Kp$p? k5 k0 0@100 ^, \`C,0p0V X \0^,0 R0Cp`0p,@(@A R(`,`PU~r =("\ 8P00C ^$Y ` k(8 "0R0wp 8Y 8 R  0 J0 0 ρ;/- Ѝ10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#PO-`,MP P  ,Ѝ( 0`(P U P  @pW p Y @Y PY 0YJPW 0 SA\V;:987G 0P @T0@p S@0Œ 0  0$ BQW Jp Zu ;Z Z PWV   R  0  @Y Z \ Z_ Z Z0  @@Z9 PZ 0Z@ZA PZ 0Z ^񏐱nkc0@@0P  R : R1:\Y Y9 4 <@S0D Ypp< 4 8<@0 @K}@ x 00o 0 0Se@#0b _ $0@[ Z \ Z Z0 S& zJ wB0 $( <@Sq Z0^0j 0(@0 Z @ 2 Rw@2s0 @ȠL8l 0@4g0 Z @2 [0 $( <@@ @ 4(B 0 0S}@#0b w 0 0n0 @40 @ȠL80 2 R@  l0z0  2 q@Z PZR 0Z}NEBZ? T@@  3S p @ 0$` 0$@ 0$0p 0$p0Qp@-P`A 0!R 40SQ 3/pvTp `DcBcV@ PP `7c5cV@p8, 2@-S ?"P !4 !1S )!P ! !1S !|P t! h!\1S TH!<P 4! (!t1S ! iP    ^0S   SP    H@$hd</  ظ<pTxT0(A-䀟`V pPub@@PT 0S 3/hb TdbW` 0R0d@R0@T PKbU@ 0pTlp@-P@T ` S 1b/b-b@T\@\P $bL@L<0Spb0Splh\# 8@-<0@T8Q PbaU@8LA-0@`P ,<P P` r 3<\ 8p`pa P@qa8aD0S @aPaAa&@-D@ 0 Sh d0`00S@-8@0S 00a0Sa@-P@P0P 0a80P $ 0a 0P0@a@RSxSi@-p @0S:?C:0S!0 0`qP @0S:?C:0UU VPPaU``0 pD0A-`VP U  @T 0S Fp'aW@@!aTP@TPaU@ @q/P aU@Aa # @-@Py/000p/  `|0p/  `0p/  `$0p/  `0G-0P0 S @`0PQpㄐ` PU `P T  @R`T PU0SLpT8@-@P P P0/S U@8`@-]|@0P 40P P@#  A-p P @P0 R `V 0S .6/ PP<@ S`  0@c L`J`AG`  0hh$i0P/ P/7`Li0RP/,`@-@B00h@-@P .@`@-e@.00# p@-H`0SpPP @`T0PU0p@_@-@P" P \ R0 ^0 0Q  Q0 R:_00A-`0S @|P|p @P LP^X L0A_0 Q _T@0<@-@ 0S  謫@-pȪت|QpX<`dH4QhЯ$l/bin/shI have no name!rbashENVBASH_ENVGNU bash, version %s-(%s) arm-unknown-linux-gnuUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... GNU long options: --%s Shell options: -irsD or -c command or -O shopt_option (invocation only) -%s or -o option Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. ??host??run_wordexp--wordexp0 0%u %u run_one_command-cFUNCNAMEBASH_SOURCEBASH_LINENO%s: is a directory%s: cannot execute binary filePOSIXLY_CORRECTPOSIX_PEDANTIC\s-\v\$ > ~/.bashrcbash%s: option requires an argument%s: invalid option%c%c: invalid optionTERMEMACSemacsdumbetermtermPS1PS2/etc/profile~/.profile~/.bash_profile~/.bash_login/opt/arm_bash/share/bashdb/bashdb-main.incdebugdebuggerdump-po-stringsdump-stringshelpnoeditingnoprofilenorcposixprotectedrcfileverboseversiontimed out waiting for input: auto-logout PROMPT_COMMANDPWD/%s TMOUTreader_loop {();&| %&'  %D)+DD.u DDAD`Mw\|DDDDbDDDDDDDDDDDDDD DUDDDEDDDDDDDDDDDDDDDDDDDDDDDDDDDDEDDDDDDDDDDDDDzDD%DDDDDDDDDDDDDDDDDDD55DDDDDD(DD0IDD DD%DDDDDD*DDDDDDDDDDDD%DDDDLLLDDDD?DDDDDcD$DDDDDDDDDDDDD DDDDDDDDDDDDDD)DDDDD. DD4 DDDDD1/9:6054738  !"#$%&'()*+,-.2= D&.$3 13 ;<3>:A:1DC  012/0B761 127jno9Grs 111797197#$% 1pqzq91t7./16716711677600:9 012: 8:!"#$%8)*+,-79 45& &'(&'(.//01012 8&8*+808 8888!"#$% )*+,-" 124579 !"#$%)*+,-0124579 !"#$%)*+,-14579 !"#$%)*+,-4579 !"#$%)*+,-4579 !"#$%)*+,-14579 !"#$%)*+,-4579 !"#$%)*+,-4579!"#$%)*+,-!"#$%45),-45?@4D3irhEsF7de;H&{ihno  uvwpqy<>{=AklIno{{T{U {fYi{44]V{W890Z*[.{^X_i44`a {\bc{z{+/44 uvw!#$%) 3"(,-uvw2   45:  6'7 ; <=>C1G  t uvw  {      {    B gJKLMNOPQRS&'a(+-.2<6308179:;u&\X  !#$ &,)/tvZYb "% `W*UT[]xywfGH45VR_z{|}~QlnpgOr=>IJS^moqP?@EFKLcshiejkCDdABMN  ;<<<<==>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>???@@AABBBBBCCCCCCCCCCCDDDDDDDDEEEEFFFFFFGGGHHHIIJKKKKKLLLMNOPPPQQRRRRSSSSSSTTUVVWWWXXXXXXYYZZZ[[\\\]]]]]^^^^^^___``DDBDDDDDDGDDDDDD1D{DRUDEDD I!"#j$%&'()*+,-./0189|}mx:2~56stdin; ;PIPESTATUSreadline stdin ; %a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEttycommand substitutionsyntax error near unexpected token `%s' ;|&syntax error near `%s'syntax error: unexpected end of filesyntax errorunexpected EOF while looking for matching `%c'caseesacunexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected EOF while looking for matching `)'evalUse "%s" to leave the shell. exit"$@"COPROCmemory exhaustedunexpected token `%s', expected `)'expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operator-nunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional commandifthenelseelifforselectwhileuntildofunction{[[]]coproc-p&&||>><<<&>&;;;&;;&<<-<<<&>&>>>|EOF<|&newline=~:~OLDPWD/dev/tty`%s': not a valid identifierPROMPT_DIRTRIM%s%sgetcwd: cannot access parent directoriesclean_simple_commandmake_redirection: redirection instruction `%d' out of rangemake_here_document: bad instruction type %dhere-document at line %d delimited by end-of-file (wanted `%s')syntax error: arithmetic expression requiredsyntax error: `;' unexpectedsyntax error: `((%s))'%ucprintf: `%c': invalid format character! ( ) && || [[ ]]case %s in select %s in for %s in <<%s%s> %s< %s>> %s<<< %s%d<&%d%d>&%d%d<&%s%d>&%s%d<&%d-%d>&%d-%d<&%s-%d>&%s-%d>&-&>%s&>>%s<> %s>|%stime -p do for (( | if then else print_command: bad connector `%d'function %s () { } { coproc %s print_command() do PS4(( )) '' %s ]] case %s in ''%s%s=(%s) %s=%s dispose_commandd cannot duplicate fd %d to fd %d%s: %s: bad interpreter%s_PID/dev/nullcannot redirect standard input from /dev/null: %seval_builtinbuiltin_envreturn_temp_envexecute_cond_nodeloop_redirectionspipe-file-descriptorsexecute_connection%s: readonly functionexecute_commandexecute-commandPS3#? LINESCOLUMNS%*d%s%sfunction_callingexecute-shell-functionsimple-commandsaved redirectssaved_redirects%s: restricted: cannot specify `/' in command namescommand_not_found_handle%s: command not foundexecute_coproc: coproc [%d:%s] still existsreal %2R user %2U sys %2S real %3lR user %3lU sys %3lSTIMEFORMAT: `%c': invalid format characterpop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextIFSpop_scope: head of shell_variables not a temporary environment scopeBASH_ARGVBASH_ARGC) {_=make_local_variable: no function context at current scopeOPTERRCOMP_WORDBREAKSGLOBIGNOREOPTINDignorespaceignoredupsignorebotherasedupsHISTFILE%s=PPIDshell-initSHLVLshell level (%d) too high, resetting to 1() {error importing function definition for `%s'/usr/gnu/bin:/usr/local/bin:/bin:/usr/bin:.+ HOSTTYPEarmOSTYPEMACHTYPEHOSTNAME60600MAILCHECKBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRING~/.bash_history~/.sh_historyIGNOREEOFignoreeofHISTCONTROLHISTIGNOREHISTTIMEFORMATUIDEUIDSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMLINENOBASHPIDHISTCMDDIRSTACKGROUPSBASH_CMDSBASH_ALIASESall_local_variables: no function context at current scopeHISTFILESIZEHISTSIZEHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistchars@Xl|$last command: %s (null)Aborting...%s: %s: %d%s: line %s: %s:%s%d: warning: %s: readonly variable%s: unbound variablebash-maintainers@gnu.orgunknown command errorbad command typebad connectorbad jump%s%s%s: %s (error token is "%s")attempted assignment to non-variabledivision by 0bug: bad expassign tokenexpression recursion level exceededsyntax error in expressionrecursion stack underflowinvalid numberinvalid arithmetic basevalue too great for base*/%+-&^|syntax error: operand expectedsyntax error: invalid arithmetic operatoridentifier expected after pre-increment or pre-decrementmissing `)'exponent less than 0`:' expected for conditional expressionaefhTiܯk̯nȯprtįuԯvЯxBTCدEHTIPT%ld wait_for(%ld): %sSignal %d (core dumped)wait: pid %ld is not a child of this shellwaitfork: retryforkcannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1%s: cannot assign list to array memberbad substitution: no closing `%s' in %s$($[[>(<(cannot make pipe for process substitution/dev/fd/cannot make child for process substitutioncannot duplicate named pipe %s as fd %dprocess substitutionbad substitution: no closing "`" in %s-Ano match: %s#%^,~:-=?+/}#%:-=?+/}%:=+/%s: substring expression < 0%s: bad substitution??$%s: cannot assign in this way%s: parameter null or not setYou have mail in $_You have new mail in $_The mail in %s has been read /var/mailinterrupt trapreturn traperror trapdebug trapexit trapinvalid signal numberrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselftraptrap_handler: bad signal %dSIGcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %dcannot reset nodelay mode for fd %dargument expected%s: integer expression expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many argumentsL%s.%d(%d)-%s4.0releaseGNU bash, version %s (%s) Copyright (C) 2009 Free Software Foundation, Inc.License GPLv3+: GNU GPL version 3 or later This is free software; you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. @(#)Bash version 4.0.0(1) release GNU ;|&( ;|&()`'()'bad array subscript%s[%s: %s[%s]: %s%s: invalid associative array key%s: cannot assign to non-numeric index%s: %s: must use subscript when assigning associative arrayarray assign%s: cannot convert indexed to associative array..%0*d,%s%s%s%s: cannot create: %s500;&()|<>P`%s: first non-whitespace character is not `"'no closing `%c' in %s%s: missing colon separatorREADLINE_LINEREADLINE_POINTbash_execute_unix_commandbash_execute_unix_command: cannot find keymap for command$@$completion-ignore-case;|&{(`$include hostname_completion_file/etc/hostssymlink-hook()<>;&| _EmptycmD_Bashshell-expand-linehistory-expand-linemagic-spaceshell-forward-wordshell-backward-wordshell-kill-wordshell-backward-kill-wordhistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-historydabbrev-expand'" \"'@<>=;|&()#$`?*[!:{~%s %dinput-metaC-xC-efc -e vifc -e "${VISUAL:-${EDITOR:-vi}}"fc -e "${VISUAL:-${EDITOR:-emacs}}" "' "comment-begin#FIGNORE "'@><=;|&(: "'><=;|&(:POSIX"" #: %s:%d msgid %s%s msgstr "" setlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %ssetlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %s/opt/arm_bash/share/localeredirection error: cannot duplicate fdfile descriptor out of range%s: ambiguous redirect%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here-document: %ssh-thd/dev/tcp/*/*/dev/udp/*/*COMP_LINECOMP_POINTCOMP_TYPECOMP_KEYCOMP_WORDSCOMP_CWORDcompletion: function `%s' not foundgen-shell-function-matchesCOMPREPLYprogcomp_insert: %s: NULL COMPSPECxrealloc: cannot reallocate %lu bytes (%lu bytes allocated)xmalloc: cannot allocate %lu bytes (%lu bytes allocated)EXITSIGPWRSIGSTKFLTSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGSYSSIGPIPESIGALRMSIGTERMSIGURGSIGSTOPSIGTSTPSIGCONTSIGCHLDSIGTTINSIGTTOUSIGIOSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGUSR1SIGUSR2SIGJUNK(%d)DEBUGERRRETURNxh0`   X  xp"H%%T&*-p/4P7@=pDE(U0W@Y[p\p\ ^iXjkosz|<~<H<@ЎdX0̣d0plalias [-p] [name[=value] ... ]unaliasunalias [-a] name [name ...]bindbind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]breakbreak [n]continuecontinue [n]builtin [shell-builtin [arg ...]]callercaller [expr]cd [-L|-P] [dir]pwdpwd [-LP]truefalsecommand [-pVv] command [arg ...]declaredeclare [-aAfFilrtux] [-p] [name[=value] ...]typesettypeset [-aAfFilrtux] [-p] name[=value] ...locallocal [option] name[=value] ...echo [-neE] [arg ...]enableenable [-a] [-dnps] [-f filename] [name ...]eval [arg ...]getoptsgetopts optstring name [arg]execexec [-cl] [-a name] [command [arguments ...]] [redirection ...]exit [n]logout [n]fcfc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]hashhash [-lr] [-p pathname] [-dt] [name ...]help [-ds] [pattern ...]history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]killkill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]letlet arg [arg ...]readread [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-p prompt] [-t timeout] [-u fd] [name ...]returnreturn [n]set [--abefhkmnptuvxBCHP] [-o option-name] [arg ...]unsetunset [-f] [-v] [name ...]exportexport [-fn] [name[=value] ...] or export -preadonlyreadonly [-af] [name[=value] ...] or readonly -pshiftshift [n]sourcesource filename [arguments]. filename [arguments]testtest [expr][ arg... ]timestrap [-lp] [[arg] signal_spec ...]type [-afptP] name [name ...]ulimitulimit [-SHacdefilmnpqrstuvx] [limit]umaskumask [-p] [-S] [mode]wait [pid]for NAME [in WORDS ... ] ; do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donetime [-p] pipelinecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donecoproc [NAME] command [redirections]function name { COMMANDS ; } or name () { COMMANDS ; }{ ... }%job_spec [&](( ... ))(( expression ))[[ ... ]][[ expression ]]variablesvariables - Names and meanings of some shell variablespushdpushd [-n] [+N | -N | dir]popdpopd [-n] [+N | -N]dirs [-clpv] [+N] [-N]shoptshopt [-pqsu] [-o] [optname ...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]compgencompgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [word]compoptcompopt [-o|+o option] [name ...]mapfilemapfile [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readarrayreadarray [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]Define or display aliases. Without arguments, `alias' prints the list of aliases in the reusable form `alias NAME=VALUE' on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Options: -p Print all defined aliases in a reusable format Exit Status: alias returns true unless a NAME is supplied for which no alias has been defined.Remove each NAME from the list of defined aliases. Options: -a remove all alias definitions. Return success unless a NAME is not an existing alias.Set Readline key bindings and variables. Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: e.g., bind '"\C-x\C-r": re-read-init-file'. Options: -m keymap Use KEYMAP as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input. -V List variable names and values -v List variable names and values in a form that can be reused as input. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -r keyseq Remove the binding for KEYSEQ. -f filename Read key bindings from FILENAME. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. Exit Status: bind returns 0 unless an unrecognized option is given or an error occurs.Exit for, while, or until loops. Exit a FOR, WHILE or UNTIL loop. If N is specified, break N enclosing loops. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Resume for, while, or until loops. Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resumes the Nth enclosing loop. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Execute shell builtins. Execute SHELL-BUILTIN with arguments ARGs without performing command lookup. This is useful when you wish to reimplement a shell builtin as a shell function, but need to execute the builtin within the function. Exit Status: Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is not a shell builtin..Return the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0. Exit Status: Returns 0 unless the shell is not executing a shell function or EXPR is invalid.Change the shell working directory. Change the current directory to DIR. The default DIR is the value of the HOME shell variable. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, the word is assumed to be a variable name. If that variable has a value, its value is used for DIR. Options: -L force symbolic links to be followed -P use the physical directory structure without following symbolic links The default is to follow symbolic links, as if `-L' were specified. Exit Status: Returns 0 if the directory is changed; non-zero otherwise.Print the name of the current working directory. Options: -L print the value of $PWD if it names the current working directory -P print the physical directory, without any symbolic links By default, `pwd' behaves as if `-L' were specified. Exit Status: Returns 0 unless an invalid option is given or the current directory cannot be read.Null command. No effect; the command does nothing. Exit Status: Always succeeds.Return a successful result. Exit Status: Always succeeds.Return an unsuccessful result. Exit Status: Always fails.Execute a simple command or display information about commands. Runs COMMAND with ARGS suppressing shell function lookup, or display information about the specified COMMANDs. Can be used to invoke commands on disk when a function with the same name exists. Options: -p use a default value for PATH that is guaranteed to find all of the standard utilities -v print a description of COMMAND similar to the `type' builtin -V print a more verbose description of each COMMAND Exit Status: Returns exit status of COMMAND, or failure if COMMAND is not found.Set variable values and attributes. Declare variables and give them attributes. If no NAMEs are given, display the attributes and values of all variables. Options: -f restrict action or display to function names and definitions -F restrict display to function names only (plus line number and source file when debugging) -p display the attributes and value of each NAME Options which set attributes: -a to make NAMEs indexed arrays (if supported) -A to make NAMEs associative arrays (if supported) -i to make NAMEs have the `integer' attribute -l to convert NAMEs to lower case on assignment -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -u to convert NAMEs to upper case on assignment -x to make NAMEs export Using `+' instead of `-' turns off the given attribute. Variables with the integer attribute have arithmetic evaluation (see the `let' command) performed when the variable is assigned a value. When used in a function, `declare' makes NAMEs local, as with the `local' command. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Set variable values and attributes. Obsolete. See `help declare'.Define local variables. Create a local variable called NAME, and give it VALUE. OPTION can be any option accepted by `declare'. Local variables can only be used within a function; they are visible only to the function where they are defined and its children. Exit Status: Returns success unless an invalid option is supplied, an error occurs, or the shell is not executing a function.Write arguments to the standard output. Display the ARGs on the standard output followed by a newline. Options: -n do not append a newline -e enable interpretation of the following backslash escapes -E explicitly suppress interpretation of backslash escapes `echo' interprets the following backslash-escaped characters: \a alert (bell) \b backspace \c suppress further output \e escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits \xHH the eight-bit character whose value is HH (hexadecimal). HH can be one or two hex digits Exit Status: Returns success unless a write error occurs.Enable and disable shell builtins. Enables and disables builtin shell commands. Disabling allows you to execute a disk command which has the same name as a shell builtin without using a full pathname. Options: -a print a list of builtins showing whether or not each is enabled -n disable each NAME or display a list of disabled builtins -p print the list of builtins in a reusable format -s print only the names of Posix `special' builtins Options controlling dynamic loading: -f Load builtin NAME from shared object FILENAME -d Remove a builtin loaded with -f Without options, each NAME is enabled. To use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. Exit Status: Returns success unless NAME is not a shell builtin or an error occurs.Execute arguments as a shell command. Combine ARGs into a single string, use the result as input to the shell, and execute the resulting commands. Exit Status: Returns exit status of command or success if command is null.Parse option arguments. Getopts is used by shell procedures to parse positional parameters as options. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead. Exit Status: Returns success if an option is found; fails if the end of options is encountered or an error occurs.Replace the shell with the given command. Execute COMMAND, replacing this shell with the specified program. ARGUMENTS become the arguments to COMMAND. If COMMAND is not specified, any redirections take effect in the current shell. Options: -a name pass NAME as the zeroth argument to COMMAND -c execute COMMAND with an empty environment -l place a dash in the zeroth argument to COMMAND If the command cannot be executed, a non-interactive shell exits, unless the shell option `execfail' is set. Exit Status: Returns success unless COMMAND is not found or a redirection error occurs.Exit the shell. Exits the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Exit a login shell. Exits a login shell with exit status N. Returns an error if not executed in a login shell.Display or execute commands from the history list. fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. Options: -e ENAME select which editor to use. Default is FCEDIT, then EDITOR, then vi -l list lines instead of editing -n omit line numbers when listing -r reverse the order of the lines (newest listed first) With the `fc -s [pat=rep ...] [command]' format, COMMAND is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command. Exit Status: Returns success or status of executed command; non-zero if an error occurs.Remember or display program locations. Determine and remember the full pathname of each command NAME. If no arguments are given, information about remembered commands is displayed. Options: -d forget the remembered location of each NAME -l display in a format that may be reused as input -p pathname use PATHNAME is the full pathname of NAME -r forget all remembered locations -t print the remembered location of each NAME, preceding each location with the corresponding NAME if multiple NAMEs are given Arguments: NAME Each NAME is searched for in $PATH and added to the list of remembered commands. Exit Status: Returns success unless NAME is not found or an invalid option is given.Display information about builtin commands. Displays brief summaries of builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise the list of help topics is printed. Options: -d output short description for each topic -m display usage in pseudo-manpage format -s output only a short usage synopsis for each topic matching PATTERN Arguments: PATTERN Pattern specifiying a help topic Exit Status: Returns success unless PATTERN is not found or an invalid option is given.Display or manipulate the history list. Display the history list with line numbers, prefixing each modified entry with a `*'. An argument of N lists only the last N entries. Options: -c clear the history list by deleting all of the entries -d offset delete the history entry at offset OFFSET. -a append history lines from this session to the history file -n read all history lines not already read from the history file -r read the history file and append the contents to the history list -w write the current history to the history file and append them to the history list -p perform history expansion on each ARG and display the result without storing it in the history list -s append the ARGs to the history list as a single entry If FILENAME is given, it is used as the history file. Otherwise, if $HISTFILE has a value, that is used, else ~/.bash_history. If the $HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise. Exit Status: Returns success unless an invalid option is given or an error occurs.Send a signal to a job. Send the processes identified by PID or JOBSPEC the signal named by SIGSPEC or SIGNUM. If neither SIGSPEC nor SIGNUM is present, then SIGTERM is assumed. Options: -s sig SIG is a signal name -n sig SIG is a signal number -l list the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and allows processes to be killed if the limit on processes that you can create is reached. Exit Status: Returns success unless an invalid option is given or an error occurs.Evaluate arithmetic expressions. Evaluate each ARG as an arithmetic expression. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. Exit Status: If the last ARG evaluates to 0, let returns 1; let returns 0 otherwise..Read a line from the standard input and split it into fields. Reads a single line from the standard input, or from file descriptor FD if the -u option is supplied. The line is split into fields as with word splitting, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with any leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. Options: -a array assign the words read to sequential indices of the array variable ARRAY, starting at zero -d delim continue until the first character of DELIM is read, rather than newline -e use Readline to obtain the line in an interactive shell -i text Use TEXT as the initial text for Readline -n nchars return after reading NCHARS characters rather than waiting for a newline -p prompt output the string PROMPT without a trailing newline before attempting to read -r do not allow backslashes to escape any characters -s do not echo input coming from a terminal -t timeout time out and return failure if a complete line of input is not read withint TIMEOUT seconds. The value of the TMOUT variable is the default timeout. TIMEOUT may be a fractional number. If TIMEOUT is 0, read returns success only if input is available on the specified file descriptor. The exit status is greater than 128 if the timeout is exceeded -u fd read from file descriptor FD instead of the standard input Exit Status: The return code is zero, unless end-of-file is encountered, read times out, or an invalid file descriptor is supplied as the argument to -u.Return from a shell function. Causes a function or sourced script to exit with the return value specified by N. If N is omitted, the return status is that of the last command executed within the function or script. Exit Status: Returns N, or failure if the shell is not executing a function or script.Set or unset values of shell options and positional parameters. Change the value of shell attributes and positional parameters, or display the names and values of shell variables. Options: -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the Posix standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG trap is inherited by shell functions. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed. Exit Status: Returns success unless an invalid option is given.Unset values and attributes of shell variables and functions. For each NAME, remove the corresponding variable or function. Options: -f treat each NAME as a shell function -v treat each NAME as a shell variable Without options, unset first tries to unset a variable, and if that fails, tries to unset a function. Some variables cannot be unset; also see `readonly'. Exit Status: Returns success unless an invalid option is given or a NAME is read-only.Set export attribute for shell variables. Marks each NAME for automatic export to the environment of subsequently executed commands. If VALUE is supplied, assign VALUE before exporting. Options: -f refer to shell functions -n remove the export property from each NAME -p display a list of all exported variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Mark shell variables as unchangeable. Mark each NAME as read-only; the values of these NAMEs may not be changed by subsequent assignment. If VALUE is supplied, assign VALUE before marking as read-only. Options: -a refer to indexed array variables -A refer to associative array variables -f refer to shell functions -p display a list of all readonly variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Shift positional parameters. Rename the positional parameters $N+1,$N+2 ... to $1,$2 ... If N is not given, it is assumed to be 1. Exit Status: Returns success unless N is negative or greater than $#.Execute commands from a file in the current shell. Read and execute commands from FILENAME in the current shell. The entries in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed. Exit Status: Returns the status of the last command executed in FILENAME; fails if FILENAME cannot be read.Evaluate conditional expression. Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators as well, and numeric comparison operators. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2. Exit Status: Returns success if EXPR evaluates to true; fails if EXPR evaluates to false or an invalid argument is given.Evaluate conditional expression. This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Display process times. Prints the accumulated user and system times for the shell and all of its child processes. Exit Status: Always succeeds.Trap signals and other events. Defines and activates handlers to be run when the shell receives signals or other conditions. ARG is a command to be read and executed when the shell receives the signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed before every simple command. If no arguments are supplied, trap prints the list of commands associated with each signal. Options: -l print a list of signal names and their corresponding numbers -p display the trap commands associated with each SIGNAL_SPEC Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. A signal may be sent to the shell with "kill -signal $$". Exit Status: Returns success unless a SIGSPEC is invalid or an invalid option is given.Display information about command type. For each NAME, indicate how it would be interpreted if used as a command name. Options: -a display all locations containing an executable named NAME; includes aliases, builtins, and functions, if and only if the `-p' option is not also used -f suppress shell function lookup -P force a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed -p returns either the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file'. -t output a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or not found, respectively Arguments: NAME Command name to be interpreted. Exit Status: Returns success if all of the NAMEs are found; fails if any are not found.Modify shell resource limits. Provides control over the resources available to the shell and processes it creates, on systems that allow such control. Options: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -b the socket buffer size -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display or set file mode mask. Sets the user file-creation mask to MODE. If MODE is omitted, prints the current value of the mask. If MODE begins with a digit, it is interpreted as an octal number; otherwise it is a symbolic mode string like that accepted by chmod(1). Options: -p if MODE is omitted, output in a form that may be reused as input -S makes the output symbolic; otherwise an octal number is output Exit Status: Returns success unless MODE is invalid or an invalid option is given.Wait for process completion and return exit status. Waits for the specified process and reports its termination status. If PID is not given, all currently active child processes are waited for, and the return code is zero. PID must be a process ID. Exit Status: Returns the status of ID; fails if ID is invalid or an invalid option is given.Execute commands for each member in a list. The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed. Exit Status: Returns the status of the last command executed.Arithmetic for loop. Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1. Exit Status: Returns the status of the last command executed.Select words from a list and execute commands. The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed. Exit Status: Returns the status of the last command executed.Report time consumed by pipeline's execution. Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. Options: -p print the timing summary in the portable Posix format The value of the TIMEFORMAT variable is used as the output format. Exit Status: The return status is the return status of PIPELINE.Execute commands based on pattern matching. Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns. Exit Status: Returns the status of the last command executed.Execute commands based on conditional. The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true. Exit Status: Returns the status of the last command executed.Execute commands as long as a test succeeds. Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero. Exit Status: Returns the status of the last command executed.Execute commands as long as a test does not succeed. Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero. Exit Status: Returns the status of the last command executed.Create a coprocess named NAME. Execute COMMAND asynchronously, with the standard output and standard input of the command connected via a pipe to file descriptors assigned to indices 0 and 1 of an array variable NAME in the executing shell. The default NAME is "COPROC". Exit Status: Returns the exit status of COMMAND.Define shell function. Create a shell function named NAME. When invoked as a simple command, NAME runs COMMANDs in the calling shell's context. When NAME is invoked, the arguments are passed to the function as $1...$n, and the function's name is in $FUNCNAME. Exit Status: Returns success unless NAME is readonly.Group commands as a unit. Run a set of commands in a group. This is one way to redirect an entire set of commands. Exit Status: Returns the status of the last command executed.Resume job in foreground. Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'. Exit Status: Returns the status of the resumed job.Evaluate arithmetic expression. The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION". Exit Status: Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Execute conditional command. Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators: ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. When the `=~' operator is used, the string to the right of the operator is matched as a regular expression. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value. Exit Status: 0 or 1 depending on value of EXPRESSION.Common shell variable names and usage. BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directories given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Add directories to stack. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. Options: -n Suppresses the normal change of directory when adding directories to the stack, so only the stack is manipulated. Arguments: +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. dir Adds DIR to the directory stack at the top, making it the new current working directory. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Remove directories from stack. Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and changes to the new top directory. Options: -n Suppresses the normal change of directory when removing directories from the stack, so only the stack is manipulated. Arguments: +N Removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N Removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Display directory stack. Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. Options: -c clear the directory stack by deleting all of the elements -l do not print tilde-prefixed versions of directories relative to your home directory -p print the directory stack with one entry per line -v print the directory stack with one entry per line prefixed with its position in the stack Arguments: +N Displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N Displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Set and unset shell options. Change the setting of each shell option OPTNAME. Without any option arguments, list all shell options with an indication of whether or not each is set. Options: -o restrict OPTNAMEs to those defined for use with `set -o' -p print each shell option with an indication of its status -q suppress output -s enable (set) each OPTNAME -u disable (unset) each OPTNAME Exit Status: Returns success if OPTNAME is enabled; fails if an invalid option is given or OPTNAME is disabled.Formats and prints ARGUMENTS under control of the FORMAT. Options: -v var assign the output to shell variable VAR rather than display it on the standard output FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output; character escape sequences, which are converted and copied to the standard output; and format specifications, each of which causes printing of the next successive argument. In addition to the standard format specifications described in printf(1) and printf(3), printf interprets: %b expand backslash escape sequences in the corresponding argument %q quote the argument in a way that can be reused as shell input Exit Status: Returns success unless an invalid option is given or a write or assignment error occurs.Specify how arguments are to be completed by Readline. For each NAME, specify how arguments are to be completed. If no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. Options: -p print existing completion specifications in a reusable format -r remove a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications When completion is attempted, the actions are applied in the order the uppercase-letter options are listed above. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Modify or display completion options. Modify the completion options for each NAME, or, if no NAMEs are supplied, the completion currently begin executed. If no OPTIONs are givenm, print the completion options for each NAME or the current completion specification. Options: -o option Set completion option OPTION for each NAME Using `+o' instead of `-o' turns off the specified option. Arguments: Each NAME refers to a command for which a completion specification must have previously been defined using the `complete' builtin. If no NAMEs are supplied, compopt must be called by a function currently generating completions, and the options for that currently-executing completion generator are modified. Exit Status: Returns success unless an invalid option is supplied or NAME does not have a completion specification defined.Read lines from the standard input into an array variable. Read lines from the standard input into the array variable ARRAY, or from file descriptor FD if the -u option is supplied. The variable MAPFILE is the default ARRAY. Options: -n count Copy at most COUNT lines. If COUNT is 0, all lines are copied. -O origin Begin assigning to ARRAY at index ORIGIN. The default index is 0. -s count Discard the first COUNT lines read. -t Remove a trailing newline from each line read. -u fd Read lines from file descriptor FD instead of the standard input. -C callback Evaluate CALLBACK each time QUANTUM lines are read. -c quantum Specify the number of lines read between each call to CALLBACK. Arguments: ARRAY Array variable name to use for file data. If -C is supplied without -c, the default quantum is 5000. When CALLBACK is evaluated, it is supplied the index of the next array element to be assigned as an additional argument. If not supplied with an explicit origin, mapfile will clear ARRAY before assigning to it. Exit Status: Returns success unless an invalid option is given or ARRAY is readonly.Read lines from a file into an array variable. A synonym for `mapfile'.alias `%s': invalid alias nameline editing not enabledbind_builtinlvpVPsSf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via , "%s"%s`%s': cannot unbindonly meaningful in a `for', `while', or `until' looploop countNULL%s %s %s PWD=LPOLDPWD=chdirHOME not setOLDPWD not setCDPATHpvVcommand_builtin/bin:/usr/bin:/sbin:/usr/sbin:/etc:/usr/etc%s: error retrieving current directory: %s: %s %s: usage: line %d: error setting terminal attributes: %serror getting terminal attributes: %swrite error: %s%s: not a shell builtin%s: restricted%s: %s out of range`%s': not a pid or valid job spec%s: invalid signal specificationSIGJUNKUnknown%2d) %s%d invalid octal numberinvalid hex number%s: invalid option name%s: not found%s: numeric argument required`'+acfilprtuxAFcannot use `-f' to make functions%s %d %s %s: cannot destroy array variables in this way%s: cannot convert associative to indexed arraycan only be used in a functionneEdynamic loading not availableadnpsf:enable %s enable -n %s %s: not a regular file%s: file is too large_evalfileparse_string topparse_stringparse_and_execute toppe_disposeparse_and_executecla:%s: cannot execute: %s~/.bash_logoutnot login shell: use `exit'logout exit :e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %c%s %s${FCEDIT:-${EDITOR:-vi}}${FCEDIT:-${EDITOR:-ed}}fc builtin%4d %s builtin hash -p %s %s hashing disableddlp:rt-thits command %s: hash table empty %s %s: cannot open: %sdmsThese shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keyword `Shell commands matching keywords `%s - %*s%s - SYNOPSIS%*s%s DESCRIPTION%*s%*s%s SEE ALSO%*sbash(1) IMPLEMENTATIONno help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrwcannot use more than one of -anrw%s: history expansion failedhistory position%5d%c %s%s Unknown error(%ld) - %s%s: invalid file descriptor specification%d: invalid file descriptor: %s%s: invalid line count%s: invalid array origin%s: invalid callback quantumu:n:O:tC:c:s:internal error: getting variable nameempty array variable nameMAPFILEdirstackdirectory stack emptydirectory stack index%2d %s %2d %s--no other directory%s: invalid timeout specificationersa:d:i:n:p:t:u:read_builtinread error: %d: %scan only `return' from a function or sourced script\ahBlkite|EThHUktjTkmCnfutPHDjpv(lki,x10editing-modefvcannot simultaneously unset a function and a variable%s: cannot unset%s: cannot unset: readonly %s%s: not an array variableSHELLOPTSoff%-15s %s set %co %s allexportbraceexpanderrexiterrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognounsetonecmdphysicalpipefailprivilegedvixtracedeclare -%s %s -%s aAfnp%s: not a function-ra-rAshift countfilename argument required%s: file not foundunknowntrap -- %s %d trap -- %s %s lp%s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptPchxde fxi lmnpq r(s<tHTu\v px (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %s`%c': bad commandhardsoftlimit%s: cannot modify limit: %score file sizeblocksdata seg sizekbytesscheduling priorityfile sizepending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile locksagou`%c': invalid symbolic mode operatorrwx`%c': invalid symbolic mode characteru=%s,g=%s,o=%s Sp -Sumask%s %04lo OPTARG?hp|TVxl|lppSp V,8DP\h$V,xT4t|WlS$ 4b@%s: invalid shell option name-u-sshopt %s %s psuoqcannot set and unset shell options simultaneouslyautocdcdable_varscdspellcheckhashcheckwinsizecmdhistcompat31compat32dirspelldotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoreglobstargnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echomissing hex digit for \xwarning: %s: %s#'-+ 0v:hjlLtz`%s': missing format characterlld%s: illegal option -- %c %s: option requires an argument -- %c  (4<@ap|\b\c@ d4@eKf LgT@jk\Ls, X@uv-r-Eabcdefgjko:prsuvA:G:W:P:S:X:F:C:E%s: invalid action namewarning: -F option may not work as you expectwarning: -C option may not work as you expectcomplete -o %s bashdefaultdirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-v-A %s arrayvarbindingenabledhelptopichostnamerunningsetoptsignalstopped%s %s -G-W-P-S-X-C-F%s: no completion specificationcompopt +o %s +o:not currently executing completion functiongroupjobuserBASH_REMATCH/dev/std%s: bad network path specificationconnect%ldm%d.%03dssh_makepathsh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s-%luw+%s/cur%s/tmp%s/new%s/%s%s/newcurinvalid base0123456789abcdef0123456789ABCDEF'd ../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../..OAOBOCODOHOF5.1_*\AaIiCcDdPpYyRrSsXx~ hl^$0ftFT;,%wbeWBE|` l|h^0%bBFT` l|hwW^0bBFT` l|h^0bBFT`0 | 4HXp$(`l܎ $$0D\lX08Ժ8HH  .Xh0pؒ(8`̫xT8  H$.4@xLXhtx,ďld ̊ 0Ċ@L,\xl|}oȄ{~ p(8DuT`Hml$\~td~ry̞Hwv(8@PH(uT`l|tē0abortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbackward-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-chardelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-wordhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-linekill-regionkill-wordmenu-completenext-historynon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-againoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linerevert-lineself-insertset-markstart-kbd-macrotab-inserttilde-expandtranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-towarning: turning off output flushing//--More--Display all %d possibilities? (y or n)bad value %d for what_to_do in rl_complete "\'`@$><=;|&{("'DcDcLkTs(\{\{$\{0d\ct|cH\ < D <P<\Hh|$48`P`tx@<HDLLPT\ ` h l t|   DH Pnoneaudiblevisiblebell-stylecompletion-prefix-display-lengthcompletion-query-itemshistory-sizeisearch-terminatorskeymapset %s %s %s is set to `%s' "%s%s": "%s" %s%s outputs %s \M-\e\C-%c\C-?blink-matching-parenprefer-visible-bellterm=mode=%s: line %d: %s $else found without matching $if$endif without matching $if# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on C-\M-unknown parser directiveno closing `"' in key bindingControl-Metaprefix-metaINPUTRC~/.inputrc/etc/inputrcC-CTRL-M-otherbind-tty-special-charsbyte-orientedconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modemark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsprint-completions-horizontallyrevert-all-at-newlineshow-all-if-ambiguousshow-all-if-unmodifiedvisible-statsemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertendifincludeDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTabreverse-i-search)`':  _rl_col_width: called with MB_CUR_MAX == 1*debug: insert_some_chars: count (%d) != col (%d)\%o/var/tmp/rltrace.%ldreadline: /-_=~.#$readline_callback_read_char() called with no handler!Pl1,( t0tNcoli amxnkmMT@7DCclcrdceiickDkHkIkdkekhklkrkummmopcvbvs(arg: %d) X%luXh|() <>;&|$"'`unknown expansion error:$*%^ = ;&()|<>event not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitution.history ~ ~2Kn@   virtual memory exhausted /etc/termcapascii?*+@!alnumalphablankcntrldigitgraphlowerprintpunctupperxdigitNULSOHSTXETXEOTENQACKalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusminusdashperiodfull-stopzerotwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettilde?*+@!asciiwordalnumNULSOHSTXETXEOTENQACKalertBSbackspaceHTLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELFATAL: kernel too old FATAL: cannot determine kernel version /dev/fullunknown errorLOCPATH/h <T(n- locale_codeset != ((void *)0)findlocale.c/usr/lib/locale_nl_find_localeVo.          cnt < (sizeof (_nl_value_type_LC_NUMERIC) / sizeof (_nl_value_type_LC_NUMERIC[0]))loadlocale.ccnt < (sizeof (_nl_value_type_LC_TIME) / sizeof (_nl_value_type_LC_TIME[0]))cnt < (sizeof (_nl_value_type_LC_COLLATE) / sizeof (_nl_value_type_LC_COLLATE[0]))cnt < (sizeof (_nl_value_type_LC_MONETARY) / sizeof (_nl_value_type_LC_MONETARY[0]))cnt < (sizeof (_nl_value_type_LC_MESSAGES) / sizeof (_nl_value_type_LC_MESSAGES[0]))cnt < (sizeof (_nl_value_type_LC_PAPER) / sizeof (_nl_value_type_LC_PAPER[0]))cnt < (sizeof (_nl_value_type_LC_NAME) / sizeof (_nl_value_type_LC_NAME[0]))cnt < (sizeof (_nl_value_type_LC_ADDRESS) / sizeof (_nl_value_type_LC_ADDRESS[0]))cnt < (sizeof (_nl_value_type_LC_TELEPHONE) / sizeof (_nl_value_type_LC_TELEPHONE[0]))cnt < (sizeof (_nl_value_type_LC_MEASUREMENT) / sizeof (_nl_value_type_LC_MEASUREMENT[0]))cnt < (sizeof (_nl_value_type_LC_IDENTIFICATION) / sizeof (_nl_value_type_LC_IDENTIFICATION[0]))category == __LC_CTYPE/SYS__nl_intern_locale_dataarchmapped == &headmaploadarchive.c((((ps) - 1) & (ps)) == 0)last->next == mappedranges[cnt].from >= from_nl_archive_subfreeres/usr/lib/locale/locale-archive_nl_load_locale_from_archiveANSI_X3.4-1968/h <T(w$^[yY]^[nN].u'u'$<=.$)$|$%p%t%g%t%m%t%f $%a%N%f%N%d%N%b%N%s %h %e %r%N%C-%z %T%N%c%NH$+%c %a %l$i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999$4DTX\$ISO/IEC 14652 i18n FDCC-setISO/IEC JTC1/SC22/WG20 - internationalizationC/o Keld Simonsen, Skt. Jorgens Alle 8, DK-1615 Kobenhavn VKeld Simonsenkeld@dkuug.dk+45 3122-6543+45 3325-6543ISO1.01997-12-20$  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%s%s%s:%u: %s%sAssertion `%s' failed. Unexpected error. OUTPUT_CHARSETcharset=LANGUAGE.momessages/usr/share/localellillollullxllXI/locale.aliasiso$ )-$                        plural=nplurals=l != ((void *)0)cxa_atexit.c__new_exitfnUUUU?3333*$I$qtEUUU;$I8^Cy 0 ,d! p= ^B{ I$ B|uPq  UUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqqinfinitynan d'@Bʚ; d'o#ſt[Am-jd8n헧?O>. 8/t#ڰͼ3&N|.[Ӿr؇/PkpnJؕnq&fƭ$6ZB<TcsUe(U܀n_S  62kg /SP L  d <  X ܫ < Ԥ  ܦ ܵ t | 0 Է T P  $ T        < < < < < < < < < ܦ ܵ t | 0 Է T P  $ T < < < < < < < < < < < ܵ t | 0 Է T P  $ T < < < < < < < < < < < ` < < < | 0 Է < < < <  < < < < < < < < < < < < < < < < < < < < | 0 Է T P  $ < < < < < < < < < < < < < < t < < | 0 Է T P  $ < < < < < < < < < < < < < < < < < ȫ T `   h Į < < < to_outpunct(unsigned int) done < (unsigned int) 2147483647vfprintf.c(size_t) done <= (size_t) 2147483647(nil)*** %n in writable segment detected *** ((&mbstate)->__count == 0)s->_flags2 & 4*** invalid %N$ use detected *** _IO_vfprintf_internalINFNANnaninfINFNAN0.0001*decimal != '\0' && decimalwc != L''printf_fphex.c__printf_fphex(((fmt[i]) & ~0x7f) == 0)fxprintf.c__fxprintf 0000000000000000 HW P d < @ X ܫ  LIBC_FATAL_STDERR_======= Backtrace: ========= ======= Memory map: ======== /proc/self/maps 00000000000000004  u ` j | o  ~ 4d | l P  4  Tn ` j | o L ~ 4d | P  4  (n ` j | o L ~ 4d | l P  status == __codecvt_partialwfileops.c_IO_wfile_underflow4 $  L , L L ؄ d | P  4  L   d | l P  4 L  L  L  d | l P  ,ccs=fcts.towc_nsteps == 1fileops.cfcts.tomb_nsteps == 1_IO_new_file_fopen , P d < @ X ܫ  offset >= oldendstrops.cenlarge_userbuf*** glibc detected *** %s: %s: 0x%s *** malloc: top chunk is corruptcorrupted double-linked listp->fd_nextsize->bk_nextsize == pmalloc.cp->bk_nextsize->fd_nextsize == pnextchunk->fd_nextsize->bk_nextsize == nextchunknextchunk->bk_nextsize->fd_nextsize == nextchunkCHECK_TOP_PAD_PERTURB_MMAP_MAX_TRIM_THRESHOLD_MMAP_THRESHOLD_ms->av[2*i+3] == 0hooks.c((p)->size & 0x2)munmap_chunk(): invalid pointerret == 0free(): invalid pointerfree(): invalid next size (fast)free(): invalid next size (normal)free(): invalid sizedouble free or corruption (fasttop)double free or corruption (top)double free or corruption (out)double free or corruption (!prev)free(): corrupted unsorted chunksheap->ar_ptr == avp->size == (0|0x1)arena.cnew_size>0 && new_size<(long)(2*(unsigned long)((((__builtin_offsetof (struct malloc_chunk, fd_nextsize))+((2 * (sizeof(size_t))) - 1)) & ~((2 * (sizeof(size_t))) - 1))))new_size>0 && new_size<(2 * (512 * 1024))((unsigned long)((char*)p + new_size) & (pagesz-1)) == 0((char*)p + new_size) == ((char*)heap + heap->size)(char *) ((void*)((char*)(p) + 2*(sizeof(size_t)))) + 4 * (sizeof(size_t)) <= paligned_mem(char *) p + size > paligned_memmalloc(): memory corruption (fast)malloc(): smallbin double linked list corruptedmalloc(): memory corruption(bck->bk->size & 0x4) == 0(fwd->size & 0x4) == 0victim->fd_nextsize->bk_nextsize == victimvictim->bk_nextsize->fd_nextsize == victimmalloc(): corrupted unsorted chunksbit != 0(unsigned long)(size) >= (unsigned long)(nb)malloc(): corrupted unsorted chunks 2((unsigned long)(nb) < (unsigned long)(64 * (2 * (sizeof(size_t)))))((size_t)((void*)((char*)(mm) + 2*(sizeof(size_t)))) & ((2 * (sizeof(size_t))) - 1)) == 0(old_top == (((mbinptr) (((char *) &((av)->bins[((1) - 1) * 2])) - __builtin_offsetof (struct malloc_chunk, fd)))) && old_size == 0) || ((unsigned long) (old_size) >= (unsigned long)((((__builtin_offsetof (struct malloc_chunk, fd_nextsize))+((2 * (sizeof(size_t))) - 1)) & ~((2 * (sizeof(size_t))) - 1))) && ((old_top)->size & 0x1) && ((unsigned long)old_end & pagemask) == 0)(unsigned long)(old_size) < (unsigned long)(nb + (unsigned long)((((__builtin_offsetof (struct malloc_chunk, fd_nextsize))+((2 * (sizeof(size_t))) - 1)) & ~((2 * (sizeof(size_t))) - 1))))!(((av)->flags & (1U)) == 0)break adjusted to free malloc spacecorrection >= 0((unsigned long)((void*)((char*)(brk) + 2*(sizeof(size_t)))) & ((2 * (sizeof(size_t))) - 1)) == 0newsize >= nb && (((unsigned long)(((void*)((char*)(p) + 2*(sizeof(size_t)))))) % alignment) == 0 !mem || ((((mchunkptr)((char*)(mem) - 2*(sizeof(size_t)))))->size & 0x2) || av == (((((mchunkptr)((char*)(mem) - 2*(sizeof(size_t)))))->size & 0x4) ? ((heap_info *)((unsigned long)(((mchunkptr)((char*)(mem) - 2*(sizeof(size_t))))) & ~((2 * (512 * 1024))-1)))->ar_ptr : &main_arena)nclears >= 3!p || ((((mchunkptr)((char*)(p) - 2*(sizeof(size_t)))))->size & 0x2) || ar_ptr == (((((mchunkptr)((char*)(p) - 2*(sizeof(size_t)))))->size & 0x4) ? ((heap_info *)((unsigned long)(((mchunkptr)((char*)(p) - 2*(sizeof(size_t))))) & ~((2 * (512 * 1024))-1)))->ar_ptr : &main_arena)!victim || ((((mchunkptr)((char*)(victim) - 2*(sizeof(size_t)))))->size & 0x2) || ar_ptr == (((((mchunkptr)((char*)(victim) - 2*(sizeof(size_t)))))->size & 0x4) ? ((heap_info *)((unsigned long)(((mchunkptr)((char*)(victim) - 2*(sizeof(size_t))))) & ~((2 * (512 * 1024))-1)))->ar_ptr : &main_arena)Arena %d: system bytes = %10u in use bytes = %10u Total (incl. mmap): max mmap regions = %10u max mmap bytes = %10lu realloc(): invalid old sizerealloc(): invalid next size!((oldp)->size & 0x2)next->fd_nextsize->bk_nextsize == nextnext->bk_nextsize->fd_nextsize == nextncopies >= 3(unsigned long)(newsize) >= (unsigned long)(nb)((size + offset) & (mp_.pagesize-1)) == 0(((unsigned long)(((void*)((char*)(p) + 2*(sizeof(size_t))))) & ((2 * (sizeof(size_t))) - 1)) == 0)(p->prev_size == offset)realloc(): invalid pointer!newp || ((((mchunkptr)((char*)(newp) - 2*(sizeof(size_t)))))->size & 0x2) || ar_ptr == (((((mchunkptr)((char*)(newp) - 2*(sizeof(size_t)))))->size & 0x4) ? ((heap_info *)((unsigned long)(((mchunkptr)((char*)(newp) - 2*(sizeof(size_t))))) & ~((2 * (512 * 1024))-1)))->ar_ptr : &main_arena)malloc_consolidatemunmap_chunk_int_freeheap_trim_int_mallocsYSMALLOcmTRIm__libc_calloc__libc_pvalloc_int_memalign__libc_valloc__libc_memalign__libc_reallocmremap_chunk_int_realloc__libc_malloc__malloc_set_stateUnknown error Real-time signal %dUnknown signal %dstatus == __GCONV_OK || status == __GCONV_EMPTY_INPUT || status == __GCONV_ILLEGAL_INPUT || status == __GCONV_INCOMPLETE_INPUT || status == __GCONV_FULL_OUTPUTmbrtowc.c((data.__statep)->__count == 0)__mbrtowcwcrtomb.c__wcrtombdata.__outbuf[-1] == '\0'wcsrtombs.cdata.__outbuf != (unsigned char *) dst__wcsrtombsresult > 0mbsnrtowcs.c__mbsnrtowcs((uintptr_t) table) % __alignof__ (table[0]) == 0../string/strcoll_l.c((uintptr_t) weights) % __alignof__ (weights[0]) == 0((uintptr_t) extra) % __alignof__ (extra[0]) == 0((uintptr_t) indirect) % __alignof__ (indirect[0]) == 0__wcscoll_lCLCClntlnC4ANSI_X3.4-1968//TRANSLIT((wchar_t *) data.__outbuf)[-1] == L''mbsrtowcs_l.c__mbsrtowcs_l%[A-Za-z]%n%hu%n:%hu%n:%hu%nM%hu.%hu.%hu%n/etc/localtimeUniversalUTCGMTnum_types == 2tzfile.cnum_types == 1__extension__ ({ size_t __s1_len, __s2_len; (__builtin_constant_p (&zone_names[info->idx]) && __builtin_constant_p (__tzname[tp->tm_isdst]) && (__s1_len = strlen (&zone_names[info->idx]), __s2_len = strlen (__tzname[tp->tm_isdst]), (!((size_t)(const void *)((&zone_names[info->idx]) + 1) - (size_t)(const void *)(&zone_names[info->idx]) == 1) || __s1_len >= 4) && (!((size_t)(const void *)((__tzname[tp->tm_isdst]) + 1) - (size_t)(const void *)(__tzname[tp->tm_isdst]) == 1) || __s2_len >= 4)) ? __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) : (__builtin_constant_p (&zone_names[info->idx]) && ((size_t)(const void *)((&zone_names[info->idx]) + 1) - (size_t)(const void *)(&zone_names[info->idx]) == 1) && (__s1_len = strlen (&zone_names[info->idx]), __s1_len < 4) ? (__builtin_constant_p (__tzname[tp->tm_isdst]) && ((size_t)(const void *)((__tzname[tp->tm_isdst]) + 1) - (size_t)(const void *)(__tzname[tp->tm_isdst]) == 1) ? __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) : (__extension__ ({ __const unsigned char *__s2 = (__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]); register int __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[0] - __s2[0]); if (__s1_len > 0 && __result == 0) { __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[1] - __s2[1]); if (__s1_len > 1 && __result == 0) { __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[2] - __s2[2]); if (__s1_len > 2 && __result == 0) __result = (((__const unsigned char *) (__const char *) (&zone_names[info->idx]))[3] - __s2[3]); } } __result; }))) : (__builtin_constant_p (__tzname[tp->tm_isdst]) && ((size_t)(const void *)((__tzname[tp->tm_isdst]) + 1) - (size_t)(const void *)(__tzname[tp->tm_isdst]) == 1) && (__s2_len = strlen (__tzname[tp->tm_isdst]), __s2_len < 4) ? (__builtin_constant_p (&zone_names[info->idx]) && ((size_t)(const void *)((&zone_names[info->idx]) + 1) - (size_t)(const void *)(&zone_names[info->idx]) == 1) ? __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) : (__extension__ ({ __const unsigned char *__s1 = (__const unsigned char *) (__const char *) (&zone_names[info->idx]); register int __result = __s1[0] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[0]; if (__s2_len > 0 && __result == 0) { __result = (__s1[1] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[1]); if (__s2_len > 1 && __result == 0) { __result = (__s1[2] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[2]); if (__s2_len > 2 && __result == 0) __result = (__s1[3] - ((__const unsigned char *) (__const char *) (__tzname[tp->tm_isdst]))[3]); } } __result; }))) : __builtin_strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst])))); }) == 0../TZDIRTZifposixrules__tzfile_compute__tzfile_read/usr/share/zoneinfo%m/%d/%y%Y-%m-%d%I:%M:%S %pgetgrent_rsetgrentendgrentgetpwent_rsetpwentendpwentgetpwnam_rgetpwuid_rself->tid != ppid../nptl/sysdeps/unix/sysv/linux/fork.c((struct pthread *)__builtin_thread_pointer () - 1)->tid == ppid__libc_fork/proc/sys/fs/xfs/restrict_chown/proc/sys/kernel/ngroups_max/proc/sys/kernel/rtsig-maxPOSIX_V7_ILP32_OFF32POSIX_V7_ILP32_OFFBIGPOSIX_V6_ILP32_OFF32POSIX_V6_ILP32_OFFBIGXBS5_ILP32_OFF32XBS5_ILP32_OFFBIG-D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64-D_LARGEFILE64_SOURCEglibc 2.11.1NPTL 2.11.1/bin:/usr/bin ``   2 `` ( tcpudp!dccpudplitesctpsctpraw(hostsdns [!UNAVAIL=return] filesgethostbyname4_rgethostbyname3_rgethostbyname2_rgetcanonname_rorig_name != ((void *)0)../sysdeps/posix/getaddrinfo.csrc->results[i].native == -1 || src->results[i].native == a1_nativesrc->results[i].native == -1 || src->results[i].native == a2_nativea1->source_addr.sin6_family == 2a2->source_addr.sin6_family == 2a1->source_addr.sin6_family == 10a2->source_addr.sin6_family == 10/etc/gai.conflabelreloadscopev4precedence((((__const uint32_t *) (sin6->sin6_addr.__in6_u.__u6_addr32))[0] == 0) && (((__const uint32_t *) (sin6->sin6_addr.__in6_u.__u6_addr32))[1] == 0) && (((__const uint32_t *) (sin6->sin6_addr.__in6_u.__u6_addr32))[2] == (__extension__ ({ register unsigned int __bsx = (0xffff); ((((__bsx) & 0xff000000u) >> 24) | (((__bsx) & 0x00ff0000u) >> 8) | (((__bsx) & 0x0000ff00u) << 8) | (((__bsx) & 0x000000ffu) << 24)); }))))canonname == ((void *)0)getaddrinfogaih_inetrfc3484_sort*Of(BOnAddress family for hostname not supportedTemporary failure in name resolutionBad value for ai_flagsNon-recoverable failure in name resolutionai_family not supportedMemory allocation failureNo address associated with hostnameName or service not knownServname not supported for ai_socktypeai_socktype not supportedSystem errorProcessing request in progressRequest canceledRequest not canceledAll requests doneInterrupted by a signalParameter string not correctly encodedSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \),Hex D_num >= 0regexec.cnode->next == ((void *)0)regcomp.cleft > -1right > -1!((node->token.type) & 8)16 >= ((pstr)->mb_cur_max + 0)regex_internal.cerr == REG_ESPACEUTF-8No previous regular expressionregs_allocated == 2regs->num_regs >= nregspmatch[0].rm_so == startre_search_stubbuild_wcs_upper_bufferbuild_wcs_buffercheck_matchingpop_fail_stackre_copy_regsparse_bracket_explink_nfa_nodes__libc_errno != 34 || buf != ((void *)0) || size != 0../sysdeps/unix/sysv/linux/getcwd.c__getcwdstdoutstderr/proc/self/fd//dev/pts/dev/dev/logsyslog: unknown facility/priority: %xout of memory [<%d>%h %e %T [%d]/dev/console%s /proc/meminfoMemFree: %ld kBMemTotal: %ld kB*cp <= *re../sysdeps/unix/sysv/linux/getsysstats.c/proc/stat/proc/cpuinfoprocessor/sys/devices/system/cpunext_lineordertrimspoofmultinospoofspoofalertreorderifaddrs != ((void *)0)res_hconf.c%s: line %d: expected `on' or `off', found `%s' %s: line %d: cannot specify more than %d trim domains%s: line %d: list delimiter not followed by domainRESOLV_HOST_CONF/etc/host.conf%s: line %d: bad command `%s' %s: line %d: ignoring trailing garbage `%s' RESOLV_SPOOF_CHECKRESOLV_MULTIRESOLV_REORDERRESOLV_ADD_TRIM_DOMAINSRESOLV_OVERRIDE_TRIM_DOMAINS_res_hconf_reorder_addrs/etc/resolv.confaliasesethersgrouphostsnetgroupnetworkspasswdprotocolspublickeyrpcservicesshadowlibnss_.solibnss_files.so.2_nss_SUCCESSUNAVAILNOTFOUNDTRYAGAINCONTINUEillegal status in __nss_next/etc/nsswitch.confnis [NOTFOUND=return] filescompat [NOTFOUND=return] filespasswd+0x-0x[0xlibcidn.so.1idna_to_ascii_lzidna_to_unicode_lzlzxn--gethostbyaddr_rgetservbyname_rgetservent_rsetserventendserventifa_data_ptr <= (char *) &ifas[newlink + newaddr] + ifa_data_size../sysdeps/unix/sysv/linux/ifaddrs.cgetifaddrs((uintptr_t) len & (__alignof__ (*len) - 1)) == 0nscd_getgr_r.cnscd_getgr_rLOCALDOMAINsock == -1nscd_getai.c__nscd_getaiservices/var/run/nscd/socketmapped->counter == 0nscd_helper.c__nscd_unmap/var/tmp/var/profileGCONV_PATHGETCONF_DIRHOSTALIASESLD_AUDITLD_DEBUGLD_DEBUG_OUTPUTLD_DYNAMIC_WEAKLD_LIBRARY_PATHLD_ORIGIN_PATHLD_PRELOADLD_PROFILELD_SHOW_AUXVLD_USE_LOAD_BIASLOCALDOMAINLOCPATHMALLOC_TRACENIS_PATHNLSPATHRESOLV_HOST_CONFRES_OPTIONSTMPDIRTZDIRswphalfthumb26bitfast-multfpavfpedspjavaiwmmxtLD_WARNLD_LIBRARY_PATHLD_BIND_NOWLD_BIND_NOTLD_DYNAMIC_WEAKLD_PROFILE_OUTPUT/etc/suid-debugMALLOC_CHECK_LD_ASSUME_KERNEL_dl_open_hookGLIBC_PRIVATE/proc/sys/kernel/osreleaselnirreversible != ((void *)0)gconv.coutbuf != ((void *)0) && *outbuf != ((void *)0)__gconvderiv->steps[cnt].__shlib_handle != ((void *)0)gconv_db.cstep->__shlib_handle != ((void *)0)step->__end_fct == ((void *)0)free_derivation__gconv_release_stepUCS4//ISO-10646/UCS4/UCS-4//ISO-10646/UCS4/UCS-4BE//ISO-10646/UCS4/CSUCS4//ISO-10646/UCS4/ISO-10646//ISO-10646/UCS4/10646-1:1993//ISO-10646/UCS4/10646-1:1993/UCS4/ISO-10646/UCS4/OSF00010104//ISO-10646/UCS4/OSF00010105//ISO-10646/UCS4/OSF00010106//ISO-10646/UCS4/WCHAR_T//INTERNALUTF8//ISO-10646/UTF8/UTF-8//ISO-10646/UTF8/ISO-IR-193//ISO-10646/UTF8/OSF05010001//ISO-10646/UTF8/ISO-10646/UTF-8/ISO-10646/UTF8/UCS2//ISO-10646/UCS2/UCS-2//ISO-10646/UCS2/OSF00010100//ISO-10646/UCS2/OSF00010101//ISO-10646/UCS2/OSF00010102//ISO-10646/UCS2/ANSI_X3.4//ANSI_X3.4-1968//ISO-IR-6//ANSI_X3.4-1968//ANSI_X3.4-1986//ANSI_X3.4-1968//ISO_646.IRV:1991//ANSI_X3.4-1968//ASCII//ANSI_X3.4-1968//ISO646-US//ANSI_X3.4-1968//US-ASCII//ANSI_X3.4-1968//US//ANSI_X3.4-1968//IBM367//ANSI_X3.4-1968//CP367//ANSI_X3.4-1968//CSASCII//ANSI_X3.4-1968//OSF00010020//ANSI_X3.4-1968//UNICODELITTLE//ISO-10646/UCS2/UCS-2LE//ISO-10646/UCS2/UCS-2BE//UNICODEBIG//elem != ((void *)0)gconv_conf.ccwd != ((void *)0)modulegconv-modulesISO-10646/UCS4/=INTERNAL->ucs4=ucs4->INTERNALUCS-4LE//=INTERNAL->ucs4le=ucs4le->INTERNALISO-10646/UTF8/=INTERNAL->utf8=utf8->INTERNALISO-10646/UCS2/=ucs2->INTERNAL=INTERNAL->ucs2ANSI_X3.4-1968//=ascii->INTERNAL=INTERNAL->asciiUNICODEBIG//=ucs2reverse->INTERNAL=INTERNAL->ucs2reverse/usr/lib/gconv__gconv_get_pathm mmmtn\nԷ0n@npdntxn4nncnt < sizeof (map) / sizeof (map[0])gconv_builtin.c__gconv_get_builtin_transoutbufstart == ((void *)0)../iconv/skeleton.cinptr - bytebuf > (state->__count & 7)../iconv/loop.cinend != &bytebuf[4]inend - inptr > (state->__count & ~7)inend - inptr <= 7inend - *inptrp < 4inend != &bytebuf[6]outbuf == outerrnstatus == __GCONV_FULL_OUTPUT*outptrp + 4 > outendgconv_simple.c__gconv_transform_internal_ucs2reverseinternal_ucs2reverse_loop_single__gconv_transform_ucs2reverse_internalucs2reverse_internal_loop_single__gconv_transform_internal_ucs2internal_ucs2_loop_single__gconv_transform_ucs2_internalucs2_internal_loop_single__gconv_transform_utf8_internalutf8_internal_loop_single__gconv_transform_internal_utf8internal_utf8_loop_single__gconv_transform_internal_asciiinternal_ascii_loop_single__gconv_transform_ascii_internal__gconv_transform_ucs4le_internalucs4le_internal_loopucs4le_internal_loop_unaligned__gconv_transform_internal_ucs4leinternal_ucs4le_loop_unaligned__gconv_transform_ucs4_internal__gconv_transform_internal_ucs4gconv_trans_contextgconv_transgconv_trans_initgconv_trans_endtrans->name != ((void *)0)gconv_trans.c__gconv_translit_findGCONV_PATH/usr/lib/gconv/gconv-modules.cacheobj->counter > 0gconv_dl.cfound->handle == ((void *)0)gconvgconv_initgconv_enddo_release_shlib__gconv_find_shlibLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_PAPERLC_NAMELC_ADDRESSLC_TELEPHONELC_MEASUREMENTLC_IDENTIFICATION +3?HP[hw        `     `  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ~~~~>>xx(( 8HHHHHIupperloweralphadigitxdigitspaceprintgraphblankcntrlpunctalnumtouppertolowerVv}y lč$HTd^@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ 23IRRSS                    " $ % & / 5 6 7 9 : < D G H I _ ` a b c !!!!! ! ! ! !!!!!!!!!!!!!!!"!$!&!(!,!-!.!/!0!1!3!4!9!E!F!G!H!I!S!T!U!V!W!X!Y!Z![!\!]!^!_!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!!!!!!!""""#"6"<"d"e"j"k"""$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$#$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%%$%,%4%<%%t*u*v*00Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2222222222222222q3r3s3t3u3v333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333) MNOPRTUVWYZ[\_`abcdefhijk  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    !"#$%&'()*+,-./0123456789;<=>@ABCDFJKLMNOPRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ %,37:>BFJNRVZ^aeimquy} !#%).38;@EHKNQTWZ]`cgjmpsv{ "&+158<ADGJMPTY]`diosvz !&+05:?DIMRW[_cgkpsw| %+17=CIOUY]aeimquy~ #(-27<AFKPUZ_dinsx} "',16;>ADGJMPSVY\_dhmpsy !',049=AEIMQUY]aflptx| &*.26:>BFJNRVZ^bflptx~              ! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z ] ` c f i k n q t w z }          " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y |          ! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z ] ` c f i l o r u x { ~          # & ) , / 2 5 8 ; > A D G J M P S V Y \ _ b e h k n q t w z }          " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y |    !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz} (C)<<-(R)u,>> 1/4 1/2 3/4 AExssaeIJij'nOEOEoeoesLJLjljNJNjnjDZDzdz'^'`_:~ -------'','"",,"+o...... ``````<>!!/???!!? RsEURa/ca/sCc/oc/ugHHHhIILlNNoPQRRRTEL(TM)ZOhmZBCeeEFMoiDdeij 1/3 2/3 1/5 2/5 3/5 4/5 1/6 5/6 1/8 3/8 5/8 7/8 1/IIIIIIIVVVIVIIVIIIIXXXIXIILCDMiiiiiiivvviviiviiiixxxixiilcdm<--><-><==><=>-/\*|:~<=>=<<>><<<>>>NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUSSPDEL_NL(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(0)-|+++++++++o::====== =(21)(22)(23)(24)(25)(26)(27)(28)(29)(30)(31)(32)(33)(34)(35)(36)(37)(38)(39)(40)(41)(42)(43)(44)(45)(46)(47)(48)(49)(50)hPadaAUbaroVpcpAnAuAmAkAKBMBGBcalkcalpFnFuFugmgkgHzkHzMHzGHzTHzulmldlklfmnmummmcmkmmm^2cm^2m^2km^2mm^3cm^3m^3km^3m/sm/s^2PakPaMPaGParadrad/srad/s^2psnsusmspVnVuVmVkVMVpWnWuWmWkWMWa.m.BqcccdC/kgCo.dBGyhaHPinKKKMktlmlnloglxmbmilmolPHp.m.PPMPRsrSvWbfffiflffifflst+___,.;:?!(){}#&*+-<>=\$%@!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefgijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzACDGJKNOPQSTUVWXYZabcdfhijkmnpqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABDEFGJKLMNOPQSTUVWXYabcdefghijklmnopqrstuvwxyzABDEFGIJKLMOSTUVWXYabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567890123456789012345678901234567890123456789579056789?o11111111111111222 22222 2$2(2,20282D2L22T2\2d2l2x222222OLO222 33,3<3L3h33333 404@4P4`4p444444444545L5p4d5x55555686D6P6666     2:02227$SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%a %b %e %H:%M:%S %Z %YSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%a %b %e %H:%M:%S %Z %Ylibc$l_next == ((void *)0)cannot read file datafile too shortinvalid ELF headerELF file data encoding not little-endianELF file version ident does not match current oneinternal errorELF file OS ABI invalidELF file version does not match current oneonly ET_DYN and ET_EXEC can be loadedELF file's phentsize not the expected size trying file=%s cannot stat shared objectfile=%s [%lu]; generating link map r->r_state == RT_ADDcannot create shared object descriptorELF load command address/offset not properly alignedcannot dynamically load executablecannot change memory protectionscannot map zero-fill pagesELF load command alignment not page-alignedcannot allocate TLS data structures for initial threadobject file has no loadable segmentsfailed to map segment from shared objectobject file has no dynamic sectioninfo[20]->d_un.d_val == 17 || info[20]->d_un.d_val == 7dynamic-link.hinfo[9]->d_un.d_val == sizeof (Elf32_Rela)info[19]->d_un.d_val == sizeof (Elf32_Rel)shared object cannot be dlopen()edcannot allocate memory for program headercannot enable executable stack as shared object requirescannot close file descriptor dynamic: 0x%0*lx base: 0x%0*lx size: 0x%0*Zx entry: 0x%0*lx phdr: 0x%0*lx phnum: %*u cannot create search path arraysystem search pathpelem->dirname[0] == '/':;lib(l)->l_name[0] == '\0'cannot create RUNPATH/RPATH copynsid >= 0nsid < _dl_nns file=%s [%lu]; needed by %s [%lu] find library=%s [%lu]; searching RPATHRUNPATHwrong ELF class: ELFCLASS64cannot open shared object fileexpand_dynamic_string_token./_dl_map_objectadd_name_to_objectlose_dl_map_object_from_fdelf_get_dynamic_info_dl_init_paths search cache=%s /etc/ld.so.cacheld.so-1.7.0glibc-ld.so.cache1.1cache != ((void *)0)dl-cache.c_dl_load_cache_lookup(bitmask_nwords & (bitmask_nwords - 1)) == 0dl-lookup.cversion->filename == ((void *)0) || ! _dl_name_match_p (version->filename, map)symbol=%s; lookup in file=%s [%lu] out of memory version == ((void *)0) || (flags & ~(DL_LOOKUP_ADD_DEPENDENCY | DL_LOOKUP_GSCOPE_LOCK)) == 0version != ((void *)0)
(no version symbols)symbol , version not defined in file with link time referencerelocation errorsymbol lookup error file=%s [%lu]; needed by %s [%lu] (relocation dependency) normalbinding file %s [%lu] to %s [%lu]: %s symbol `%s' [%s] _dl_setup_hashundefined symbol: _dl_lookup_symbol_xcheck_matchunexpected reloc type 0xunexpected PLT reloc type 0x! "could not map page for fixup"../ports/sysdeps/arm/dl-machine.hmap->l_tls_modid <= dtv[-1].counterdl-reloc.ccannot allocate memory in static TLS block (lazy) relocation processing: %s%s cannot make segment writable for relocation%s: Symbol `%s' has different size in shared object, consider re-linking R_ARM_PC24 relocation out of range%s: no PLTREL found in object %s %s: out of memory to store relocation results for %s cannot restore segment prot after reloccannot apply additional memory protection after relocationfix_bad_pc24_dl_nothread_init_static_tlsDYNAMIC LINKER BUG!!!error while loading shared libraries%s: %s: %s%s%s%s%s fatalcontinued%s: error: %s: %s (%s)  =???pid >= 0 && sizeof (pid_t) <= 4dl-misc.cniov < 64! "invalid format specifier"_dl_debug_vdprintfgmon.profile%s: cannot open file: %s %s: cannot create file: %s %s: file is no correct profile data file for `%s' %s: cannot map file: %s Out of memory while initializing profiler %s: cannot stat file: %s idx == 0dl-tls.cdlopencannot create TLS data structuresresult <= _dl_tls_max_dtv_idx + 1result == _dl_tls_max_dtv_idx + 1map->l_tls_modid == cntmap->l_tls_blocksize >= map->l_tls_initimage_sizelistp != ((void *)0)_dl_add_to_slotinfo_dl_allocate_tls_init_dl_next_tls_modid/proc/self/exelinkval[0] == '/'../sysdeps/unix/sysv/linux/dl-origin.c_dl_get_origininvalid mode for dlopen()no more namespaces available for dlmopen()invalid target namespace in dlmopen()_dl_debug_initialize (0, args.nsid)->r_state == RT_CONSISTENTdl-open.ccannot extend global scopens == l->l_ns_dl_debug_initialize (0, args->nsid)->r_state == RT_CONSISTENT(call_map)->l_name[0] == '\0'empty dynamic string token substitutionmode & 0x00004opening file=%s [%lu]; direct_opencount=%u cannot create scope listcannot load any more object with static TLSimap->l_need_tls_init == 0TLS generation counter wrapped! Please report this._dl_opendl_open_worker! should_be_theredl-close.cold_map->l_tls_modid == idx closing file=%s; direct_opencount=%u idx == nloaded(*lp)->l_idx >= 0 && (*lp)->l_idx < nloadedjmap->l_idx >= 0 && jmap->l_idx < nloadedimap->l_ns == nsidimap->l_type == lt_loaded && (imap->l_flags_1 & 0x00000008) == 0 calling fini: %s [%lu] tmap->l_ns == nsiddlcloseimap->l_type == lt_loaded file=%s [%lu]; destroying link map TLS generation counter wrapped! Please report as described in . map->l_init_calledshared object not open_dl_close_dl_close_workerremove_slotinfoto_inpunctcnt < (((uint32_t) (*_nl_current_LC_CTYPE)->values[((int) (_NL_CTYPE_MB_CUR_MAX) & 0xffff)].word))vfscanf.c_IO_vfscanf_internalinvalid mode parameterDST not allowed in SUID/SGID programsdl-deps.ccannot load auxiliary `%s' because of empty dynamic string token substitution load auxiliary object=%s requested by file=%s load filtered object=%s requested by file=%s cannot allocate dependency listmap->l_searchlist.r_list == ((void *)0)cannot allocate symbol search listFilters not supported with LD_TRACE_PRELINKINGcnt <= nlistmap->l_searchlist.r_list[0] == map_dl_map_object_deps((reloc->r_info) & 0xff) == 22dl-runtime.c_dl_profile_fixup_dl_fixup calling init: %s calling preinit: %s j < nmapsdl-fini.ci < nloadedns != 0 || i == nloadedns == 0 || i == nloaded || i == nloaded - 1_dl_fini_dl_sort_finichecking for version `%s' in file %s [%lu] required by file %s [%lu] no version information available (required by def_offset != 0dl-version.cunsupported version of Verdef recordweak version `' not found (required by version ` of Verneed record needed != ((void *)0)cannot allocate version reference table_dl_check_map_versionsmatch_symbolRTLD_NEXT used in code not dynamically loaded4|ܟ$Dd@l, l____FD_____________²___________________?(_)'?_H_ C\_ t_ X @  _   G___     _ __4_< F _____DD_ _H_   @p`hpx _  Tp  9   D$ <   _  @CHD_@F_?h  P 0 ߄ F߄ _   _D G  G $D_  H,<8l?_0<   h""|#$'+++T,,--. //001444x?@GJ XKKLMNNNP$SPnlox H`@_d|PTL6l,@0_|LtPl,pp dh`lh0`` <plxdD     X t t< D| X_8t/<036$@CEF_L M_N\\h`_a?.fgghhhhhi,jjjjkllHlmHmmn nn?_XB DDxE_DFDF0GHxJJLN XR|R UPUU@VVWXXYZZZ[^__aab>D>h?@T@@@0ABBDDFHHPIKMLRTmmtqqt@wDw`yhyy>$?@_A_ BD4E_LFI_ JK MQQ(R?&TTUPXd&ȟlGD ԮT/dl̳ԳLT̴ԴtTط(?@ hH L8?"X\0@tPh\L`p(8`lG$pG t(x8`_\xXl`?D $TGd   0D 0xT X   "$ %% '()0* - /1_2 3_45 7X7:$: :h: ;;GP_TQGUVYHZZGXaaaGjkXkkpGLwww_xyG||@Gԃ(P  4Ўԕ\dD8?14ع4șGؤܤ0lGpPG<Gp D  /h03 38489|9̸,:0> @4@@8BBChCCDHD?EhE8FFPQRG|XY0[`<-{L};X(P)|&   D (xptpL\p (@L@0@$4dt( < D P\l pp+D    (DHXС` Цؤx B H ## 5(`d%0P8D@ @LX Hd\PtTXlt%`%hl pl%x%\%@@@Ht|DH|$ %$ ,L p,L| %&ت*4 x;%=@U%TPL>XX\G?-Dci$$8H|(`T8$. .l8dTs̊Lk(,xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx|xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxĊpXXXXXXXXXXXXXXXXXXXXXXXXXXx,ԺXXXXXXXXXXXXXXXXXXXXXXXXXXu0(`T8$. .l8d̊Hp8y0{TP${,{$d~(uē{\~tx{rTHtē{~xxxuxxx|xxxxxx$. .l8dx̊x̞xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx|xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxд8 d\HTHp]\L!^D,Tc hx$  0 < \ h     (4DTdt (8DT  `!"#$@%t&'( )T*x+,----.8./ /`0t1234567898:(;P<=>?<@t[\\,]^^_ `T{{|}4}~      $ ( 8 < H L \`dhlptx|P\U !"#$%&'($)8*D+P,X-`-p-x-..H/X/0Z123456789:;<=>? @0[D\P\`]x^^_`{{|}}~L/h <T(w\h ) P) P )l(l(l(P? L* H< 0